Clone BS13448 Report

Search the DGRC for BS13448

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:134
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptCG13565-RA
Protein status:BS13448.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS13448.3prime Sequence

432 bp (432 high quality bases) assembled on 2006-10-13

> BS13448.3prime
ATGGTCTAGAAAGCTTCTAGACGAGCTGGTTGAGGATGCTGAAGCTGGCG
GAGGCCTTGTCGATCTCGTCGAAGTTCCGCTTGAGCTTACTGCTCCAGGT
GTCCTTGTACAGGGGGTCCATCCTCACCAGGTAGGGCACCAGGTCCCGGT
GATGGCCAGACCCGATCTTGCCGGCCGCGCACTGCTTCACCGAGTACTTC
GTCTTGAACTCCGACTGGCTGCACTCGTAGCAGACGACCGTTTGTCCATT
GGCAGCCGAAATCAATCTCACTATAAACGGTCCATCGTACTTCTTCGAGC
CAGCTTCACAAAGATATTTTCCATCCAGCAGTTCGTCGTTGGAAATATCC
ACACCGGGCGCTGCGTGAATGAAGTTCAGGAACACCGATACCACCGCCAG
GAGCACATATAGATTCATGTCGACTGATAACT

BS13448.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:38:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13565-PA 402 CG13565-RA 1..402 418..17 2010 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 11:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG13565-RA 593 CG13565-RA 59..461 419..17 2015 100 Minus
CG13565-RC 611 CG13565-RC 59..174 419..304 580 100 Minus
CG13565-RB 1071 CG13565-RB 519..634 419..304 580 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 11:42:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23947091..23947342 17..268 1260 100 Plus
2R 25286936 2R 23948488..23948558 349..419 355 100 Plus
2R 25286936 2R 23948352..23948398 304..350 235 100 Plus
2R 25286936 2R 23947616..23947655 267..306 200 100 Plus
Blast to na_te.dros performed on 2015-02-08 11:42:21 has no hits.

BS13448.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:40:56 Download gff for BS13448.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13565-PA 1..402 17..418 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:36:16 Download gff for BS13448.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 59..461 17..419 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:41:39 Download gff for BS13448.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 59..461 17..419 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:41:39 Download gff for BS13448.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 23947091..23947340 17..266 100 <- Plus
2R 23947616..23947652 267..303 100 <- Plus
2R 23948352..23948397 304..349 100 <- Plus
2R 23948489..23948558 350..419 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:36:16 Download gff for BS13448.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19834614..19834863 17..266 100 <- Plus
arm_2R 19835139..19835175 267..303 100 <- Plus
arm_2R 19835875..19835920 304..349 100 <- Plus
arm_2R 19836012..19836081 350..419 100   Plus

BS13448.5prime Sequence

432 bp (432 high quality bases) assembled on 2006-10-13

> BS13448.5prime
GAAGTTATCAGTCGACATGAATCTATATGTGCTCCTGGCGGTGGTATCGG
TGTTCCTGAACTTCATTCACGCAGCGCCCGGTGTGGATATTTCCAACGAC
GAACTGCTGGATGGAAAATATCTTTGTGAAGCTGGCTCGAAGAAGTACGA
TGGACCGTTTATAGTGAGATTGATTTCGGCTGCCAATGGACAAACGGTCG
TCTGCTACGAGTGCAGCCAGTCGGAGTTCAAGACGAAGTACTCGGTGAAG
CAGTGCGCGGCCGGCAAGATCGGGTCTGGCCATCACCGGGACCTGGTGCC
CTACCTGGTGAGGATGGACCCCCTGTACAAGGACACCTGGAGCAGTAAGC
TCAAGCGGAACTTCGACGAGATCGACAAGGCCTCCGCCAGCTTCAGCATC
CTCAACCAGCTCGTCTAGAAGCTTTCTAGACC

BS13448.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG13565-PA 402 CG13565-RA 1..402 17..418 2010 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 17:48:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13565-RA 593 CG13565-RA 59..461 16..418 2015 100 Plus
CG13565-RC 611 CG13565-RC 59..174 16..131 580 100 Plus
CG13565-RB 1071 CG13565-RB 519..634 16..131 580 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 17:47:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23947091..23947342 418..167 1260 100 Minus
2R 25286936 2R 23948488..23948558 86..16 355 100 Minus
2R 25286936 2R 23948352..23948398 131..85 235 100 Minus
2R 25286936 2R 23947616..23947655 168..129 200 100 Minus
Blast to na_te.dros performed on 2015-02-02 17:48:00 has no hits.

BS13448.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:40:56 Download gff for BS13448.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13565-PA 1..402 17..418 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 15:39:45 Download gff for BS13448.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 59..461 16..418 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 19:11:23 Download gff for BS13448.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 59..461 16..418 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 19:11:23 Download gff for BS13448.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 23947091..23947340 169..418 100 <- Minus
2R 23947616..23947652 132..168 100 <- Minus
2R 23948352..23948397 86..131 100 <- Minus
2R 23948489..23948558 16..85 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 15:39:45 Download gff for BS13448.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19834614..19834863 169..418 100 <- Minus
arm_2R 19835139..19835175 132..168 100 <- Minus
arm_2R 19835875..19835920 86..131 100 <- Minus
arm_2R 19836012..19836081 16..85 100   Minus

BS13448.complete Sequence

434 bp assembled on 2006-11-01

GenBank Submission: FJ637456

> BS13448.complete
GAAGTTATCAGTCGACATGAATCTATATGTGCTCCTGGCGGTGGTATCGG
TGTTCCTGAACTTCATTCACGCAGCGCCCGGTGTGGATATTTCCAACGAC
GAACTGCTGGATGGAAAATATCTTTGTGAAGCTGGCTCGAAGAAGTACGA
TGGACCGTTTATAGTGAGATTGATTTCGGCTGCCAATGGACAAACGGTCG
TCTGCTACGAGTGCAGCCAGTCGGAGTTCAAGACGAAGTACTCGGTGAAG
CAGTGCGCGGCCGGCAAGATCGGGTCTGGCCATCACCGGGACCTGGTGCC
CTACCTGGTGAGGATGGACCCCCTGTACAAGGACACCTGGAGCAGTAAGC
TCAAGCGGAACTTCGACGAGATCGACAAGGCCTCCGCCAGCTTCAGCATC
CTCAACCAGCTCGTCTAGAAGCTTTCTAGACCAT

BS13448.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:53:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13565-RA 402 CG13565-PA 1..402 17..418 2010 100 Plus
CG13565-RC 384 CG13565-PC 1..115 17..131 575 100 Plus
CG13565-RB 384 CG13565-PB 1..115 17..131 575 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:53:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13565-RA 593 CG13565-RA 59..461 16..418 2015 100 Plus
CG13565-RC 611 CG13565-RC 59..174 16..131 580 100 Plus
CG13565-RB 1071 CG13565-RB 519..634 16..131 580 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23947091..23947342 418..167 1260 100 Minus
2R 25286936 2R 23948488..23948558 86..16 355 100 Minus
2R 25286936 2R 23948352..23948398 131..85 235 100 Minus
2R 25286936 2R 23947616..23947655 168..129 200 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:53:24 has no hits.

BS13448.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:19:55 Download gff for BS13448.complete
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 1..402 17..418 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:51:34 Download gff for BS13448.complete
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 57..459 16..418 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:05:42 Download gff for BS13448.complete
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 60..461 17..418 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:19:56 Download gff for BS13448.complete
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 57..459 16..418 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:51:07 Download gff for BS13448.complete
Subject Subject Range Query Range Percent Splice Strand
CG13565-RA 60..461 17..418 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:51:07 Download gff for BS13448.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23947091..23947340 169..418 100 <- Minus
2R 23947616..23947652 132..168 100 <- Minus
2R 23948352..23948397 86..131 100 <- Minus
2R 23948489..23948557 17..85 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:05:42 Download gff for BS13448.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19834614..19834863 169..418 100 <- Minus
arm_2R 19835139..19835175 132..168 100 <- Minus
arm_2R 19835875..19835920 86..131 100 <- Minus
arm_2R 19836012..19836080 17..85 100   Minus

BS13448.pep Sequence

Translation from 16 to 417

> BS13448.pep
MNLYVLLAVVSVFLNFIHAAPGVDISNDELLDGKYLCEAGSKKYDGPFIV
RLISAANGQTVVCYECSQSEFKTKYSVKQCAAGKIGSGHHRDLVPYLVRM
DPLYKDTWSSKLKRNFDEIDKASASFSILNQLV*

BS13448.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG13565-PA 133 CG13565-PA 1..133 1..133 691 100 Plus
CG13565-PC 127 CG13565-PC 1..38 1..38 194 100 Plus
CG13565-PB 127 CG13565-PB 1..38 1..38 194 100 Plus