Clone BS13470 Report

Search the DGRC for BS13470

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:134
Well:70
Vector:pDNR-Dual
Associated Gene/TranscriptCG5791-RA
Protein status:BS13470.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS13470.3prime Sequence

327 bp (327 high quality bases) assembled on 2006-10-13

> BS13470.3prime
ATGGTCTAGAAAGCTTTTAATAGGGATCCACGTTGCAGTGCTGACATCTG
CCATTGACGATGGTATTACCACCCCTCCGGTAAATGGTGCCACCTCCACC
GCCACTACCGTCATTTCCACGGGAAATGACCACATTACCATCGCCAGGGG
ATGAGGAGAAGCTGCGGTACTGCTGGCCATCCAGGTAGACGGGTTCACCA
TTCGGATTGGGACAAGTCAGACAGACGCCATTCACCACCACTGTGCTGGG
ATGAGCGCCGATCAGAGTCGGAATTAAAGCCAACGGGAGCAGCACACACG
TCAGGTACTTCATGTCGACTGATAACT

BS13470.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-PA 297 CG5791-RA 1..297 313..17 1485 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 11:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-RB 629 CG5791-RB 129..431 313..11 1500 99.7 Minus
CG5791-RC 1193 CG5791-RC 21..323 313..11 1500 99.7 Minus
CG5791-RA 350 CG5791-RA 22..324 313..11 1500 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 11:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22087429..22087631 213..11 1000 99.5 Minus
3R 32079331 3R 22087203..22087260 313..256 290 100 Minus
3R 32079331 3R 22087317..22087361 256..212 225 100 Minus
Blast to na_te.dros performed on 2015-02-08 11:45:17 has no hits.

BS13470.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:41:11 Download gff for BS13470.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5791-PA 1..297 17..313 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:36:38 Download gff for BS13470.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 71..377 4..313 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:41:58 Download gff for BS13470.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 22..328 4..313 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:41:58 Download gff for BS13470.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 22087203..22087260 256..313 100 -> Minus
3R 22087318..22087359 214..255 100 -> Minus
3R 22087429..22087635 4..213 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:36:38 Download gff for BS13470.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17912925..17912982 256..313 100 -> Minus
arm_3R 17913040..17913081 214..255 100 -> Minus
arm_3R 17913151..17913357 4..213 97   Minus

BS13470.5prime Sequence

327 bp (327 high quality bases) assembled on 2006-10-13

> BS13470.5prime
GAAGTTATCAGTCGACATGAAGTACCTGACGTGTGTGCTGCTCCCGTTGG
CTTTAATTCCGACTCTGATCGGCGCTCATCCCAGCACAGTGGTGGTGAAT
GGCGTCTGTCTGACTTGTCCCAATCCGAATGGTGAACCCGTCTACCTGGA
TGGCCAGCAGTACCGCAGCTTCTCCTCATCCCCTGGCGATGGTAATGTGG
TCATTTCCCGTGGAAATGACGGTAGTGGCGGTGGAGGTGGCACCATTTAC
CGGAGGGGTGGTAATACCATCGTCAATGGCAGATGTCAGCACTGCAACGT
GGATCCCTATTAAAAGCTTTCTAGACC

BS13470.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-PA 297 CG5791-RA 1..297 17..313 1485 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:33:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-RB 629 CG5791-RB 129..431 17..319 1500 99.7 Plus
CG5791-RC 1193 CG5791-RC 21..323 17..319 1500 99.7 Plus
CG5791-RA 350 CG5791-RA 22..324 17..319 1500 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22087429..22087631 117..319 1000 99.5 Plus
3R 32079331 3R 22087203..22087260 17..74 290 100 Plus
3R 32079331 3R 22087317..22087361 74..118 225 100 Plus
Blast to na_te.dros performed on 2015-02-10 16:33:09 has no hits.

BS13470.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:41:12 Download gff for BS13470.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5791-PA 1..297 17..313 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:17:41 Download gff for BS13470.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 71..377 17..326 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:02:50 Download gff for BS13470.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 22..328 17..326 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:02:50 Download gff for BS13470.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 22087203..22087260 17..74 100 -> Plus
3R 22087318..22087359 75..116 100 -> Plus
3R 22087429..22087635 117..326 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:17:41 Download gff for BS13470.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17912925..17912982 17..74 100 -> Plus
arm_3R 17913040..17913081 75..116 100 -> Plus
arm_3R 17913151..17913357 117..326 97   Plus

BS13470.complete Sequence

329 bp assembled on 2006-11-01

GenBank Submission: FJ637467

> BS13470.complete
GAAGTTATCAGTCGACATGAAGTACCTGACGTGTGTGCTGCTCCCGTTGG
CTTTAATTCCGACTCTGATCGGCGCTCATCCCAGCACAGTGGTGGTGAAT
GGCGTCTGTCTGACTTGTCCCAATCCGAATGGTGAACCCGTCTACCTGGA
TGGCCAGCAGTACCGCAGCTTCTCCTCATCCCCTGGCGATGGTAATGTGG
TCATTTCCCGTGGAAATGACGGTAGTGGCGGTGGAGGTGGCACCATTTAC
CGGAGGGGTGGTAATACCATCGTCAATGGCAGATGTCAGCACTGCAACGT
GGATCCCTATTAAAAGCTTTCTAGACCAT

BS13470.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-RB 297 CG5791-PB 1..297 17..313 1485 100 Plus
CG5791-RC 297 CG5791-PC 1..297 17..313 1485 100 Plus
CG5791-RA 297 CG5791-PA 1..297 17..313 1485 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:24:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-RB 629 CG5791-RB 129..431 17..319 1500 99.7 Plus
CG5791-RC 1193 CG5791-RC 21..323 17..319 1500 99.7 Plus
CG5791-RA 350 CG5791-RA 22..324 17..319 1500 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22087429..22087631 117..319 1000 99.5 Plus
3R 32079331 3R 22087203..22087260 17..74 290 100 Plus
3R 32079331 3R 22087317..22087361 74..118 225 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:24:13 has no hits.

BS13470.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:44:17 Download gff for BS13470.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 1..297 17..313 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:31:27 Download gff for BS13470.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 71..377 17..326 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:53:18 Download gff for BS13470.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 71..365 17..311 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:44:17 Download gff for BS13470.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 71..377 17..326 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:17:42 Download gff for BS13470.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 22..316 17..311 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:17:42 Download gff for BS13470.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22087203..22087260 17..74 100 -> Plus
3R 22087318..22087359 75..116 100 -> Plus
3R 22087429..22087623 117..311 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:53:18 Download gff for BS13470.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17912925..17912982 17..74 100 -> Plus
arm_3R 17913040..17913081 75..116 100 -> Plus
arm_3R 17913151..17913345 117..311 100   Plus

BS13470.pep Sequence

Translation from 16 to 312

> BS13470.pep
MKYLTCVLLPLALIPTLIGAHPSTVVVNGVCLTCPNPNGEPVYLDGQQYR
SFSSSPGDGNVVISRGNDGSGGGGGTIYRRGGNTIVNGRCQHCNVDPY*

BS13470.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 21:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-PB 98 CG5791-PB 1..98 1..98 539 100 Plus
CG5791-PC 98 CG5791-PC 1..98 1..98 539 100 Plus
CG5791-PA 98 CG5791-PA 1..98 1..98 539 100 Plus