Clone BS13474 Report

Search the DGRC for BS13474

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:134
Well:74
Vector:pDNR-Dual
Associated Gene/TranscriptCyt-c-p-RA
Protein status:BS13474.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS13474.3prime Sequence

357 bp (357 high quality bases) assembled on 2006-10-13

> BS13474.3prime
ATGGTCTAGAAAGCTTTTACTTGGTCGCCGACTTCAGGTAGGCGATCAGA
TCGCCGCGCTCGTTGGGCTTCTTCAGACCGGCGAAGATCATCTTGGTGCC
GGGGATGTACTTCTTGGGGTTCTCCAGGTACTCGAACAGGGTGTCCTCGT
TCCAGGTGATGCCCTTGGCCTTGTTGGCGTCCGTGTACGCGAATCCGGCC
GCCTGTCCGGTCTTGCGACCGATCAGACCATGCAGATTGGGTCCAACCTT
GTGCTTGCCACCAGCCTCAACGGTGTGGCACTGGGCGCAGCGCTGCACGA
ACAGCTTCTTTCCCTTCTCAACATCACCAGCAGGAACGCCCATGTCGACT
GATAACT

BS13474.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:39:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG17903-PA 327 Cyt-c-p-RA 1..327 343..17 1635 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 11:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
Cyt-c-p-RB 634 CG17903-RB 40..366 343..17 1635 100 Minus
Cyt-c-p-RA 681 CG17903-RA 87..413 343..17 1635 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 11:46:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16722050..16722376 343..17 1635 100 Minus
Blast to na_te.dros performed on 2015-02-08 11:46:26 has no hits.

BS13474.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:41:15 Download gff for BS13474.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17903-PA 1..327 17..343 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:36:48 Download gff for BS13474.3prime
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 83..413 17..351 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:42:06 Download gff for BS13474.3prime
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 83..413 17..351 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:42:06 Download gff for BS13474.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 16722046..16722376 17..351 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:36:48 Download gff for BS13474.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16722046..16722376 17..351 98   Minus

BS13474.5prime Sequence

357 bp (357 high quality bases) assembled on 2006-10-13

> BS13474.5prime
GAAGTTATCAGTCGACATGGGCGTTCCTGCTGGTGATGTTGAGAAGGGAA
AGAAGCTGTTCGTGCAGCGCTGCGCCCAGTGCCACACCGTTGAGGCTGGT
GGCAAGCACAAGGTTGGACCCAATCTGCATGGTCTGATCGGTCGCAAGAC
CGGACAGGCGGCCGGATTCGCGTACACGGACGCCAACAAGGCCAAGGGCA
TCACCTGGAACGAGGACACCCTGTTCGAGTACCTGGAGAACCCCAAGAAG
TACATCCCCGGCACCAAGATGATCTTCGCCGGTCTGAAGAAGCCCAACGA
GCGCGGCGATCTGATCGCCTACCTGAAGTCGGCGACCAAGTAAAAGCTTT
CTAGACC

BS13474.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG17903-PA 327 Cyt-c-p-RA 1..327 17..343 1635 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 03:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
Cyt-c-p-RB 634 CG17903-RB 40..366 17..343 1635 100 Plus
Cyt-c-p-RA 681 CG17903-RA 87..413 17..343 1635 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 03:51:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16722050..16722376 17..343 1635 100 Plus
Blast to na_te.dros performed on 2015-02-12 03:51:01 has no hits.

BS13474.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:41:15 Download gff for BS13474.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17903-PA 1..327 17..343 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:30:45 Download gff for BS13474.5prime
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 83..413 9..343 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:57:32 Download gff for BS13474.5prime
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 83..413 9..343 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:57:32 Download gff for BS13474.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 16722046..16722376 9..343 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:30:45 Download gff for BS13474.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16722046..16722376 9..343 98   Plus

BS13474.complete Sequence

359 bp assembled on 2006-11-01

GenBank Submission: FJ637471

> BS13474.complete
GAAGTTATCAGTCGACATGGGCGTTCCTGCTGGTGATGTTGAGAAGGGAA
AGAAGCTGTTCGTGCAGCGCTGCGCCCAGTGCCACACCGTTGAGGCTGGT
GGCAAGCACAAGGTTGGACCCAATCTGCATGGTCTGATCGGTCGCAAGAC
CGGACAGGCGGCCGGATTCGCGTACACGGACGCCAACAAGGCCAAGGGCA
TCACCTGGAACGAGGACACCCTGTTCGAGTACCTGGAGAACCCCAAGAAG
TACATCCCCGGCACCAAGATGATCTTCGCCGGTCTGAAGAAGCCCAACGA
GCGCGGCGATCTGATCGCCTACCTGAAGTCGGCGACCAAGTAAAAGCTTT
CTAGACCAT

BS13474.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
Cyt-c-p-RB 327 CG17903-PB 1..327 17..343 1635 100 Plus
Cyt-c-p-RA 327 CG17903-PA 1..327 17..343 1635 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:48:50
Subject Length Description Subject Range Query Range Score Percent Strand
Cyt-c-p-RB 634 CG17903-RB 40..366 17..343 1635 100 Plus
Cyt-c-p-RA 681 CG17903-RA 87..413 17..343 1635 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16722050..16722376 17..343 1635 100 Plus
Blast to na_te.dros performed on 2014-11-27 12:48:48 has no hits.

BS13474.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:39:55 Download gff for BS13474.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 1..327 17..343 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:13:29 Download gff for BS13474.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 141..471 9..343 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:37:36 Download gff for BS13474.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 87..411 17..341 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:39:55 Download gff for BS13474.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 141..471 9..343 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:05:14 Download gff for BS13474.complete
Subject Subject Range Query Range Percent Splice Strand
Cyt-c-p-RA 87..411 17..341 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:05:14 Download gff for BS13474.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16722050..16722374 17..341 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:37:36 Download gff for BS13474.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16722050..16722374 17..341 100   Plus

BS13474.pep Sequence

Translation from 16 to 342

> BS13474.pep
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAG
FAYTDANKAKGITWNEDTLFEYLENPKKYIPGTKMIFAGLKKPNERGDLI
AYLKSATK*

BS13474.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:28:34
Subject Length Description Subject Range Query Range Score Percent Strand
Cyt-c-p-PB 108 CG17903-PB 1..108 1..108 578 100 Plus
Cyt-c-p-PA 108 CG17903-PA 1..108 1..108 578 100 Plus
Cyt-c-d-PB 105 CG13263-PB 3..103 5..105 407 72.3 Plus
Cyt-c-d-PA 105 CG13263-PA 3..103 5..105 407 72.3 Plus