Clone BS13524 Report

Search the DGRC for BS13524

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:135
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptObp56e-RA
Protein status:BS13524.pep: full length peptide match
Sequenced Size:431

Clone Sequence Records

BS13524.complete Sequence

431 bp assembled on 2010-07-02

GenBank Submission: KX806238

> BS13524.complete
GAAGTTATCAGTCGACATGAAAGTATTCTTTGTGTTTGCCGCCCTTGCAG
CTCTATCTTTGGCATCTGCCGTGGGGCTAACTGATTCCCAAAAGGCTGAG
GCAAAGCAGAGAGCCAAGGCCTGCGTCAAACAGGAGGGAATCACGAAGGA
GCAAGCTATTGCCCTGCGGTCTGGAAACTTTGCAGACTCCGATCCAAAGG
TAAAGTGCTTCGCCAACTGCTTCCTGGAGCAGACCGGCCTGGTGGCCAAT
GGGCAGATAAAACCTGACGTGGTTTTGGCCAAACTAGGTCCCATCGCCGG
CGAAGCCAATGTCAAGGAGGTGCAGGCCAAGTGTGACTCGACCAAGGGAG
CCGACAAGTGCGACACTAGCTATCTGCTGTACAAGTGCTACTACGAAAAC
CACGCCCAATTCTAAAAGCTTTCTAGACCAT

BS13524.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56e-RA 399 CG8462-PA 1..399 17..415 1995 100 Plus
Obp56e-RB 396 CG8462-PB 1..396 17..415 1915 99.2 Plus
Obp56d-RB 396 CG11218-PB 112..396 131..415 255 72.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:21:28
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56e-RA 532 CG8462-RA 52..451 16..415 2000 100 Plus
Obp56e-RB 529 CG8462-RB 52..448 16..415 1920 99.2 Plus
Obp56d-RB 922 CG11218-RB 277..561 131..415 255 72.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19712509..19712851 73..415 1715 100 Plus
2R 25286936 2R 19712396..19712454 16..74 295 100 Plus
2R 25286936 2R 19703285..19703569 415..131 255 72.6 Minus
Blast to na_te.dros performed on 2014-11-28 02:21:26 has no hits.

BS13524.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 13:24:56 Download gff for BS13524.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 53..449 17..413 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:17:23 Download gff for BS13524.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 53..449 17..413 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:27:28 Download gff for BS13524.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 53..449 17..413 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:27:28 Download gff for BS13524.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19712397..19712453 17..73 100 -> Plus
2R 19712510..19712849 74..413 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:17:23 Download gff for BS13524.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15600015..15600354 74..413 100   Plus
arm_2R 15599902..15599958 17..73 100 -> Plus

BS13524.pep Sequence

Translation from 16 to 414

> BS13524.pep
MKVFFVFAALAALSLASAVGLTDSQKAEAKQRAKACVKQEGITKEQAIAL
RSGNFADSDPKVKCFANCFLEQTGLVANGQIKPDVVLAKLGPIAGEANVK
EVQAKCDSTKGADKCDTSYLLYKCYYENHAQF*

BS13524.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:34:40
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56e-PA 132 CG8462-PA 1..132 1..132 675 100 Plus
Obp56e-PB 131 CG8462-PB 1..131 1..132 659 99.2 Plus
Obp56d-PB 131 CG11218-PB 1..129 1..130 439 63.8 Plus
Obp56d-PA 131 CG11218-PA 1..129 1..130 439 63.8 Plus
Obp56a-PA 139 CG11797-PA 1..128 1..125 245 37.5 Plus