Clone BS13526 Report

Search the DGRC for BS13526

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:135
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptRpL32-RA
Protein status:BS13526.pep: full length peptide match
Sequenced Size:437

Clone Sequence Records

BS13526.complete Sequence

437 bp assembled on 2010-02-09

GenBank Submission: KX804541

> BS13526.complete
GAAGTTATCAGTCGACATGACCATCCGCCCAGCATACAGGCCCAAGATCG
TGAAGAAGCGCACCAAGCACTTCATCCGCCACCAGTCGGATCGATATGCT
AAGCTGTCGCACAAATGGCGCAAGCCCAAGGGTATCGACAACAGAGTGCG
TCGCCGCTTCAAGGGACAGTATCTGATGCCCAACATCGGTTACGGATCGA
ACAAGCGCACCCGCCACATGCTGCCCACCGGATTCAAGAAGTTCCTGGTG
CACAACGTGCGCGAGCTGGAGGTCCTGCTCATGCAGAACCGCGTTTACTG
CGGCGAGATCGCCCACGGCGTCTCCTCCAAGAAGCGCAAGGAGATTGTCG
AGCGCGCCAAGCAGCTGTCGGTCCGCCTCACCAACCCCAACGGTCGCCTG
CGTTCTCAAGAGAACGAGTAAAAGCTTTCTAGACCAT

BS13526.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
RpL32-RD 405 CG7939-PD 1..405 17..421 2025 100 Plus
RpL32-RA 405 CG7939-PA 1..405 17..421 2025 100 Plus
RpL32-RC 444 CG7939-PC 40..444 17..421 2025 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:23:45
Subject Length Description Subject Range Query Range Score Percent Strand
RpL32-RD 747 CG7939-RD 287..691 17..421 2025 100 Plus
RpL32-RA 578 CG7939-RA 90..494 17..421 2025 100 Plus
RpL32-RC 747 CG7939-RC 259..663 17..421 2025 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:23:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30045313..30045625 421..109 1565 100 Minus
3R 32079331 3R 30045687..30045779 109..17 465 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:23:44 has no hits.

BS13526.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:15:47 Download gff for BS13526.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RA 1..405 17..421 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:09:52 Download gff for BS13526.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RB 33..435 17..419 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:58:27 Download gff for BS13526.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 259..661 17..419 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:39:58 Download gff for BS13526.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RB 33..435 17..419 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:27:38 Download gff for BS13526.complete
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 259..661 17..419 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:27:38 Download gff for BS13526.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30045315..30045624 110..419 100 <- Minus
3R 30045687..30045779 17..109 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:58:27 Download gff for BS13526.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25871409..25871501 17..109 100   Minus
arm_3R 25871037..25871346 110..419 100 <- Minus

BS13526.3prime Sequence

435 bp (435 high quality bases) assembled on 2006-10-13

> BS13526.3prime
ATGGTCTAGAAAGCTTTTACTCGTTCTCTTGAGAACGCAGGCGACCGTTG
GGGTTGGTGAGGCGGACCGACAGCTGCTTGGCGCGCTCGACAATCTCCTT
GCGCTTCTTGGAGGAGACGCCGTGGGCGATCTCGCCGCAGTAAACGCGGT
TCTGCATGAGCAGGACCTCCAGCTCGCGCACGTTGTGCACCAGGAACTTC
TTGAATCCGGTGGGCAGCATGTGGCGGGTGCGCTTGTTCGATCCGTAACC
GATGTTGGGCATCAGATACTGTCCCTTGAAGCGGCGACGCACTCTGTTGT
CGATACCCTTGGGCTTGCGCCATTTGTGCGACAGCTTAGCATATCGATCC
GACTGGTGGCGGATGAAGTGCTTGGTGCGCTTCTTCACGATCTTGGGCCT
GTATGCTGGGCGGATGGTCATGTCGACTGATAACT

BS13526.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 22:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG7939-PB 405 RpL32-RB 1..405 421..17 2025 100 Minus
CG7939-PC 444 RpL32-RC 40..444 421..17 2025 100 Minus
CG7939-PA 405 RpL32-RA 1..405 421..17 2025 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 04:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
RpL32-RD 747 CG7939-RD 287..691 421..17 2025 100 Minus
RpL32-RA 578 CG7939-RA 90..494 421..17 2025 100 Minus
RpL32-RC 747 CG7939-RC 259..663 421..17 2025 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 04:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30045313..30045625 17..329 1565 100 Plus
3R 32079331 3R 30045687..30045779 329..421 465 100 Plus
Blast to na_te.dros performed on 2015-02-12 04:45:52 has no hits.

BS13526.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:41:38 Download gff for BS13526.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7939-PA 1..405 17..421 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 07:15:56 Download gff for BS13526.3prime
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 254..671 5..426 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:06:29 Download gff for BS13526.3prime
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 254..671 5..426 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:06:29 Download gff for BS13526.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 30045305..30045624 5..328 98 <- Plus
3R 30045687..30045784 329..426 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 07:15:56 Download gff for BS13526.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25871027..25871346 5..328 98 <- Plus
arm_3R 25871409..25871506 329..426 97   Plus

BS13526.5prime Sequence

435 bp (435 high quality bases) assembled on 2006-10-13

> BS13526.5prime
GAAGTTATCAGTCGACATGACCATCCGCCCAGCATACAGGCCCAAGATCG
TGAAGAAGCGCACCAAGCACTTCATCCGCCACCAGTCGGATCGATATGCT
AAGCTGTCGCACAAATGGCGCAAGCCCAAGGGTATCGACAACAGAGTGCG
TCGCCGCTTCAAGGGACAGTATCTGATGCCCAACATCGGTTACGGATCGA
ACAAGCGCACCCGCCACATGCTGCCCACCGGATTCAAGAAGTTCCTGGTG
CACAACGTGCGCGAGCTGGAGGTCCTGCTCATGCAGAACCGCGTTTACTG
CGGCGAGATCGCCCACGGCGTCTCCTCCAAGAAGCGCAAGGAGATTGTCG
AGCGCGCCAAGCAGCTGTCGGTCCGCCTCACCAACCCCAACGGTCGCCTG
CGTTCTCAAGAGAACGAGTAAAAGCTTTCTAGACC

BS13526.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 22:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG7939-PB 405 RpL32-RB 1..405 17..421 2025 100 Plus
CG7939-PC 444 RpL32-RC 40..444 17..421 2025 100 Plus
CG7939-PA 405 RpL32-RA 1..405 17..421 2025 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:31:24
Subject Length Description Subject Range Query Range Score Percent Strand
RpL32-RD 747 CG7939-RD 287..691 17..421 2025 100 Plus
RpL32-RA 578 CG7939-RA 90..494 17..421 2025 100 Plus
RpL32-RC 747 CG7939-RC 259..663 17..421 2025 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30045313..30045625 421..109 1565 100 Minus
3R 32079331 3R 30045687..30045779 109..17 465 100 Minus
Blast to na_te.dros performed on 2015-02-12 00:31:20 has no hits.

BS13526.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:41:38 Download gff for BS13526.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7939-PA 1..405 17..421 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 04:36:17 Download gff for BS13526.5prime
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 254..671 12..433 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:04:00 Download gff for BS13526.5prime
Subject Subject Range Query Range Percent Splice Strand
RpL32-RC 254..671 12..433 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:04:00 Download gff for BS13526.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 30045305..30045624 110..433 98 <- Minus
3R 30045687..30045784 12..109 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 04:36:17 Download gff for BS13526.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25871027..25871346 110..433 98 <- Minus
arm_3R 25871409..25871506 12..109 97   Minus

BS13526.pep Sequence

Translation from 16 to 420

> BS13526.pep
MTIRPAYRPKIVKKRTKHFIRHQSDRYAKLSHKWRKPKGIDNRVRRRFKG
QYLMPNIGYGSNKRTRHMLPTGFKKFLVHNVRELEVLLMQNRVYCGEIAH
GVSSKKRKEIVERAKQLSVRLTNPNGRLRSQENE*

BS13526.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 03:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
RpL32-PD 134 CG7939-PD 1..134 1..134 705 100 Plus
RpL32-PA 134 CG7939-PA 1..134 1..134 705 100 Plus
RpL32-PB 134 CG7939-PB 1..134 1..134 705 100 Plus
RpL32-PC 147 CG7939-PC 14..147 1..134 705 100 Plus