Clone Sequence Records
BS13560.5prime Sequence
579 bp (576 high quality bases) assembled on 2006-10-13
> BS13560.5prime
GAAGTTATCAGTCGACATGGCATTCAAGTTTGTCTTCGCCCTCGCCTTCG
TCGCCGTGGCCAGCGCCGGTTATGCCCCCATCGCCGCCCCACAGGTGTAC
CACGCTGCCCCAGCGGTGGCCACCTACGCCCACGCCCCCGTGGCCGTCGC
CCAGAAGGTCGTGGTCAAGGCCGCCGAGGAGTACGACCCCCACCCCCAGT
ACCGCTTCTCCTACGGAGTCGATGACAAGCTAACCGGTGACAACAAGGGA
CAGGTGGAGGAGCGCGATGGAGATGTGGTACGCGGAGAGTACTCCCTGAT
CGACGCTGACGGCTACAAGAGGATCGTCCAGTACACCGCCGATCCCATCA
ACGGATTCAACGCCGTTGTCAACCGTGAGCCCCTGGTCAAGGCCGTCGCC
GTTGCCCCCGTTGTGAAGACCGTCGCCGCTCCCGTTGCCCAATACGCCGC
CCCTGCTGTCGCCCACTACGCTGCTCCCGCTGTGGTCAAGACCGTGGCTC
CAGTTGCCCACTACGCTGCTCCTGCTGTGGTCAAGACTGTGGCCCCAGTG
GCTCACTATGGCTGCCCCGCTGCATATGC
BS13560.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 22:19:07
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG2360-PA | 618 | Ccp84Aa-RA | 1..563 | 17..579 | 2740 | 99.6 | Plus |
| CG1252-PA | 666 | Ccp84Ab-RA | 1..563 | 17..579 | 2590 | 98.5 | Plus |
| CG2341-PA | 600 | Ccp84Ad-RA | 235..533 | 251..549 | 1145 | 95.3 | Plus |
| CG2341-PA | 600 | Ccp84Ad-RA | 490..555 | 461..526 | 280 | 96.9 | Plus |
| CG1330-PA | 627 | Ccp84Ae-RA | 190..257 | 239..306 | 190 | 91.1 | Plus |
| CG4052-PA | 438 | CG4052-RA | 241..288 | 251..298 | 165 | 93.7 | Plus |
| CG2342-PA | 576 | Ccp84Ag-RA | 256..287 | 332..363 | 160 | 100 | Plus |
| CG2341-PA | 600 | Ccp84Ad-RA | 150..186 | 166..202 | 135 | 94.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:23:49
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Ccp84Aa-RA | 765 | CG2360-RA | 64..626 | 17..579 | 2770 | 99.6 | Plus |
| Ccp84Ab-RA | 834 | CG1252-RA | 57..621 | 15..579 | 2690 | 98.6 | Plus |
| Ccp84Ad-RA | 735 | CG2341-RA | 136..608 | 92..558 | 1500 | 87.9 | Plus |
| Ccp84Aa-RA | 765 | CG2360-RA | 553..619 | 461..527 | 215 | 88.1 | Plus |
| Ccp84Ab-RA | 834 | CG1252-RA | 548..614 | 461..527 | 215 | 88.1 | Plus |
| Ccp84Aa-RA | 765 | CG2360-RA | 508..560 | 506..558 | 190 | 90.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 18:23:40
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 6704212..6704764 | 27..579 | 2705 | 99.3 | Plus |
| 3R | 32079331 | 3R | 6702181..6702733 | 579..27 | 2630 | 98.4 | Minus |
| 3R | 32079331 | 3R | 6692928..6693400 | 92..558 | 1475 | 87.9 | Plus |
| 3R | 32079331 | 3R | 6689759..6690059 | 386..92 | 465 | 77.7 | Minus |
| X | 23542271 | X | 5804927..5805179 | 144..396 | 395 | 77.1 | Plus |
| 3R | 32079331 | 3R | 6691251..6691411 | 384..224 | 385 | 82.6 | Minus |
| 3R | 32079331 | 3R | 6693348..6693413 | 461..526 | 300 | 97 | Plus |
| 3R | 32079331 | 3R | 6687163..6687299 | 251..387 | 235 | 78.1 | Plus |
| 3R | 32079331 | 3R | 6702188..6702254 | 527..461 | 215 | 88.1 | Minus |
| 3R | 32079331 | 3R | 6704691..6704757 | 461..527 | 215 | 88.1 | Plus |
| 3R | 32079331 | 3R | 6704646..6704698 | 506..558 | 190 | 90.6 | Plus |
Blast to na_te.dros performed on 2015-02-10 18:23:48 has no hits.
BS13560.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:41:55 Download gff for
BS13560.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG2360-PA | 1..563 | 17..579 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 06:51:55 Download gff for
BS13560.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Ccp84Aa-RA | 64..626 | 17..579 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 19:45:59 Download gff for
BS13560.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Ccp84Aa-RA | 64..626 | 17..579 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 19:45:59 Download gff for
BS13560.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 6704214..6704764 | 29..579 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 06:51:55 Download gff for
BS13560.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 2529936..2530486 | 29..579 | 99 | | Plus |
BS13560.complete Sequence
650 bp assembled on 2007-10-26
GenBank Submission: KX801049
> BS13560.complete
GAAGTTATCAGTCGACATGGCATTCAAGTTTGTCTTCGCCCTCGCCTTCG
TCGCCGTGGCCAGCGCCGGTTATGCCCCCATCGCCGCCCCACAGGTGTAC
CACGCTGCCCCAGCGGTGGCCACCTACGCCCACGCCCCCGTGGCCGTCGC
CCAGAAGGTCGTGGTCAAGGCCGCCGAGGAGTACGACCCCCACCCCCAGT
ACCGCTTCTCCTACGGAGTCGATGACAAGCTAACCGGTGACAACAAGGGA
CAGGTGGAGGAGCGCGATGGAGATGTGGTACGCGGAGAGTACTCCCTGAT
CGACGCTGACGGCTACAAGAGGATCGTCCAGTACACCGCCGATCCCATCA
ACGGATTCAACGCCGTTGTCAACCGTGAGCCCCTGGTCAAGGCCGTCGCC
GTTGCCCCCGTTGTGAAGACCGTCGCCGCTCCCGTTGCCCAATACGCCGC
CCCTGCTGTCGCCCACTACGCTGCTCCCGCTGTGGTCAAGACCGTGGCTC
CAGTTGCCCACTACGCTGCTCCTGCTGTGGTCAAGACTGTGGCCCCAGTG
GCTCACTATGCTGCCCCCGCTGCATATGCCACCTATGCTGCTCCCACCCA
CTACGCCGCCCCCGCTGTTGCCTACCACCCCTGAAAGCTTTCTAGACCAT
BS13560.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:59:05
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Ccp84Aa-RA | 618 | CG2360-PA | 1..618 | 17..634 | 3090 | 100 | Plus |
| Ccp84Ab-RA | 666 | CG1252-PA | 1..599 | 17..615 | 2875 | 98.7 | Plus |
| Ccp84Ad-RA | 600 | CG2341-PA | 70..555 | 92..571 | 1480 | 87.4 | Plus |
| Ccp84Aa-RA | 618 | CG2360-PA | 445..511 | 506..572 | 215 | 88.1 | Plus |
| Ccp84Aa-RA | 618 | CG2360-PA | 490..556 | 461..527 | 215 | 88.1 | Plus |
| Ccp84Ab-RA | 666 | CG1252-PA | 490..556 | 461..527 | 215 | 88.1 | Plus |
| Ccp84Ab-RA | 666 | CG1252-PA | 445..511 | 506..572 | 200 | 86.6 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:59:06
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Ccp84Aa-RA | 765 | CG2360-RA | 64..681 | 17..634 | 3090 | 100 | Plus |
| Ccp84Ab-RA | 834 | CG1252-RA | 57..657 | 15..615 | 2885 | 98.7 | Plus |
| Ccp84Ad-RA | 735 | CG2341-RA | 136..621 | 92..571 | 1480 | 87.4 | Plus |
| Ccp84Aa-RA | 765 | CG2360-RA | 508..574 | 506..572 | 215 | 88.1 | Plus |
| Ccp84Aa-RA | 765 | CG2360-RA | 553..619 | 461..527 | 215 | 88.1 | Plus |
| Ccp84Ab-RA | 834 | CG1252-RA | 548..614 | 461..527 | 215 | 88.1 | Plus |
| Ccp84Ab-RA | 834 | CG1252-RA | 503..569 | 506..572 | 200 | 86.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:59:02
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 6704212..6704819 | 27..634 | 3040 | 100 | Plus |
| 3R | 32079331 | 3R | 6702145..6702733 | 615..27 | 2840 | 98.8 | Minus |
| 3R | 32079331 | 3R | 6692928..6693413 | 92..571 | 1480 | 87.4 | Plus |
| 3R | 32079331 | 3R | 6689759..6690059 | 386..92 | 465 | 77.7 | Minus |
| X | 23542271 | X | 5804927..5805179 | 144..396 | 395 | 77.1 | Plus |
| 3R | 32079331 | 3R | 6691251..6691411 | 384..224 | 385 | 82.6 | Minus |
| 3R | 32079331 | 3R | 6693348..6693413 | 461..526 | 300 | 97 | Plus |
| 3R | 32079331 | 3R | 6687163..6687299 | 251..387 | 235 | 78.1 | Plus |
| 3R | 32079331 | 3R | 6702188..6702254 | 527..461 | 215 | 88.1 | Minus |
| 3R | 32079331 | 3R | 6704646..6704712 | 506..572 | 215 | 88.1 | Plus |
| 3R | 32079331 | 3R | 6704691..6704757 | 461..527 | 215 | 88.1 | Plus |
| 3R | 32079331 | 3R | 6702233..6702299 | 572..506 | 200 | 86.6 | Minus |
| 3R | 32079331 | 3R | 6693303..6693367 | 506..570 | 190 | 86.2 | Plus |
Blast to na_te.dros performed 2014-11-27 07:59:04
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| R1A1-element | 5356 | R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). | 600..640 | 577..620 | 122 | 81.8 | Plus |
| R1A1-element | 5356 | R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). | 601..647 | 551..597 | 109 | 70.2 | Plus |
BS13560.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:15:48 Download gff for
BS13560.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Ccp84Aa-RA | 1..618 | 17..634 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:46:46 Download gff for
BS13560.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Ccp84Aa-RA | 66..688 | 17..639 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:28:03 Download gff for
BS13560.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Ccp84Aa-RA | 64..680 | 17..633 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:40:28 Download gff for
BS13560.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Ccp84Aa-RA | 66..682 | 17..633 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:08:39 Download gff for
BS13560.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Ccp84Aa-RA | 64..680 | 17..633 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:08:39 Download gff for
BS13560.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 6704212..6704818 | 27..633 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:28:03 Download gff for
BS13560.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 2529934..2530540 | 27..633 | 100 | | Plus |
BS13560.pep Sequence
Translation from 16 to 633
> BS13560.pep
MAFKFVFALAFVAVASAGYAPIAAPQVYHAAPAVATYAHAPVAVAQKVVV
KAAEEYDPHPQYRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGY
KRIVQYTADPINGFNAVVNREPLVKAVAVAPVVKTVAAPVAQYAAPAVAH
YAAPAVVKTVAPVAHYAAPAVVKTVAPVAHYAAPAAYATYAAPTHYAAPA
VAYHP*
BS13560.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:31:08
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Ccp84Aa-PA | 205 | CG2360-PA | 1..205 | 1..205 | 1050 | 100 | Plus |
| Ccp84Ab-PA | 221 | CG1252-PA | 1..200 | 1..200 | 1015 | 99.5 | Plus |
| Ccp84Ad-PA | 199 | CG2341-PA | 1..198 | 1..204 | 824 | 81.6 | Plus |
| Ccp84Af-PA | 151 | CG1331-PA | 1..147 | 1..151 | 491 | 69.3 | Plus |
| Cpr5C-PA | 145 | CG4052-PA | 1..142 | 1..145 | 459 | 65.8 | Plus |
