Clone BS13577 Report

Search the DGRC for BS13577

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:135
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptCG16756-RA
Protein status:BS13577.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS13577.5prime Sequence

489 bp (489 high quality bases) assembled on 2006-10-13

> BS13577.5prime
GAAGTTATCAGTCGACATGAGAGCTGCGCCATTCGGATCGTGGTACTGGC
TGGGATTGGGATTGGGCCTGCTTCTGGCCATCGAGTGCGGCGTGGTTTCC
GCCAAGCGTTTCCTGCGCTGTGAACTGGCCCGCAAGTTGCTCGATCAGCA
TGGTTTCGAACGCAGTCTGCTCTCGAATTGGATTTGTTTGCTAGAGCACG
AAAGCGATCTGGATACCGGCAGGATTACAACCAATGCGAATGGATCTCGG
AACTATGGGCTGTTCCAAATCAATGGCAGGTTTTGTCAGGAGGGAAGGCG
TGGCGGCATTTGCAATGCCAAGTGCGAAGATTTTTTGGACGAAAATTTAA
GGGAGTCGGTTACTTGCGCCAAGCGCATCCAAACCTCGGATGGTTTTCGT
CATTGGGCGGGATGGCAACGATATTGCCGAAACGCCCAAAATCTGCCTAA
TCTTAAGGTTATCTGTGGGATCTAGAAGCTTTCTAGACC

BS13577.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG16756-PA 459 CG16756-RA 1..459 17..475 2270 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 10:07:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG16756-RA 521 CG16756-RA 12..471 17..476 2285 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 10:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5427528..5427691 17..180 820 100 Plus
X 23542271 X 5427806..5427959 180..333 755 99.4 Plus
X 23542271 X 5428019..5428167 328..476 730 99.3 Plus
Blast to na_te.dros performed on 2015-01-31 10:07:48 has no hits.

BS13577.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:42:07 Download gff for BS13577.5prime
Subject Subject Range Query Range Percent Splice Strand
CG16756-PA 1..459 17..475 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 23:33:32 Download gff for BS13577.5prime
Subject Subject Range Query Range Percent Splice Strand
CG16756-RA 2..471 9..476 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 12:43:06 Download gff for BS13577.5prime
Subject Subject Range Query Range Percent Splice Strand
CG16756-RA 2..471 9..476 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 12:43:06 Download gff for BS13577.5prime
Subject Subject Range Query Range Percent Splice Strand
X 5427518..5427690 9..179 98 -> Plus
X 5427806..5427955 180..329 100 -> Plus
X 5428021..5428167 330..476 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 23:33:32 Download gff for BS13577.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 5321551..5321723 9..179 98 -> Plus
arm_X 5321839..5321988 180..329 100 -> Plus
arm_X 5322054..5322200 330..476 99   Plus

BS13577.complete Sequence

491 bp assembled on 2006-11-01

GenBank Submission: FJ637484

> BS13577.complete
GAAGTTATCAGTCGACATGAGAGCTGCGCCATTCGGATCGTGGTACTGGC
TGGGATTGGGATTGGGCCTGCTTCTGGCCATCGAGTGCGGCGTGGTTTCC
GCCAAGCGTTTCCTGCGCTGTGAACTGGCCCGCAAGTTGCTCGATCAGCA
TGGTTTCGAACGCAGTCTGCTCTCGAATTGGATTTGTTTGCTAGAGCACG
AAAGCGATCTGGATACCGGCAGGATTACAACCAATGCGAATGGATCTCGG
AACTATGGGCTGTTCCAAATCAATGGCAGGTTTTGTCAGGAGGGAAGGCG
TGGCGGCATTTGCAATGCCAAGTGCGAAGATTTTTTGGACGAAAATTTAA
GGGAGTCGGTTACTTGCGCCAAGCGCATCCAAACCTCGGATGGTTTTCGT
CATTGGGCGGGATGGCAACGATATTGCCGAAACGCCCAAAATCTGCCTAA
TCTTAAGGTTATCTGTGGGATCTAGAAGCTTTCTAGACCAT

BS13577.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG16756-RA 459 CG16756-PA 1..459 17..475 2280 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG16756-RA 521 CG16756-RA 12..471 17..476 2285 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 5427528..5427691 17..180 820 100 Plus
X 23542271 X 5427806..5427959 180..333 755 99.4 Plus
X 23542271 X 5428019..5428167 328..476 730 99.3 Plus
Blast to na_te.dros performed on 2014-11-27 13:37:46 has no hits.

BS13577.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:44:20 Download gff for BS13577.complete
Subject Subject Range Query Range Percent Splice Strand
CG16756-RA 1..459 17..475 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:11:10 Download gff for BS13577.complete
Subject Subject Range Query Range Percent Splice Strand
CG16756-RA 2..471 9..476 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:20:32 Download gff for BS13577.complete
Subject Subject Range Query Range Percent Splice Strand
CG16756-RA 12..470 17..475 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:44:20 Download gff for BS13577.complete
Subject Subject Range Query Range Percent Splice Strand
CG16756-RA 2..471 9..476 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:52:14 Download gff for BS13577.complete
Subject Subject Range Query Range Percent Splice Strand
CG16756-RA 12..470 17..475 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:52:14 Download gff for BS13577.complete
Subject Subject Range Query Range Percent Splice Strand
X 5428021..5428166 330..475 99   Plus
X 5427528..5427690 17..179 100 -> Plus
X 5427806..5427955 180..329 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:20:32 Download gff for BS13577.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5321561..5321723 17..179 100 -> Plus
arm_X 5321839..5321988 180..329 100 -> Plus
arm_X 5322054..5322199 330..475 99   Plus

BS13577.pep Sequence

Translation from 16 to 474

> BS13577.pep
MRAAPFGSWYWLGLGLGLLLAIECGVVSAKRFLRCELARKLLDQHGFERS
LLSNWICLLEHESDLDTGRITTNANGSRNYGLFQINGRFCQEGRRGGICN
AKCEDFLDENLRESVTCAKRIQTSDGFRHWAGWQRYCRNAQNLPNLKVIC
GI*

BS13577.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG16756-PA 152 CG16756-PA 1..152 1..152 834 100 Plus
CG16799-PB 179 CG16799-PB 27..164 18..152 423 50 Plus
CG16799-PA 179 CG16799-PA 27..164 18..152 423 50 Plus
CG11159-PA 146 CG11159-PA 6..143 5..146 291 44.8 Plus
CG7798-PA 148 CG7798-PA 6..136 18..146 203 35.1 Plus