Clone BS13701 Report

Search the DGRC for BS13701

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:137
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptAtg8b-RA
Protein status:BS13701.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS13701.5prime Sequence

393 bp (393 high quality bases) assembled on 2006-10-13

> BS13701.5prime
GAAGTTATCAGTCGACATGGATATGAACTACCAGTACAAGAAGGACCACT
CGTTCGACAAGCGCCGCAACGAAGGCGACAAGATCCGGCGCAAGTATCCG
GACCGTGTGCCCGTCATCGTGGAAAAGGCGCCGAAGACGCGTTACGCGGA
GCTGGACAAGAAGAAGTACCTGGTGCCGGCGGACCTGACAGTGGGCCAGT
TCTACTTTCTCATCCGCAAGCGTATCAATCTGCGTCCCGACGACGCCCTC
TTCTTCTTCGTAAACAATGTGATCCCACCGACATCGGCCACCATGGGTGC
ACTGTACCAGGAGCACTTCGACAAGGACTACTTCCTCTACATTTCCTATA
CCGATGAGAACGTCTATGGACGGCAGTAGAAGCTTTCTAGACC

BS13701.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG12334-PA 363 Atg8b-RA 1..363 17..379 1815 100 Plus
CG32672-PA 366 Atg8a-RA 52..98 74..120 160 93.6 Plus
CG32672-PA 366 Atg8a-RA 175..275 197..297 155 86.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8b-RB 654 CG12334-RB 154..517 17..380 1820 100 Plus
Atg8b-RA 609 CG12334-RA 135..498 17..380 1820 100 Plus
Atg8a-RA 1214 CG32672-RA 269..606 23..360 775 82 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:44:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17724547..17724910 380..17 1820 100 Minus
X 23542271 X 10765604..10765802 311..113 470 82.4 Minus
X 23542271 X 10767979..10768070 114..23 235 83.7 Minus
Blast to na_te.dros performed on 2015-02-12 17:44:03 has no hits.

BS13701.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:42:59 Download gff for BS13701.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12334-PA 1..363 17..379 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:41:14 Download gff for BS13701.5prime
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 126..506 8..388 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 20:00:08 Download gff for BS13701.5prime
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 126..506 8..388 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 20:00:08 Download gff for BS13701.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 17724539..17724919 8..388 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:41:14 Download gff for BS13701.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13550261..13550641 8..388 97   Minus

BS13701.3prime Sequence

393 bp (393 high quality bases) assembled on 2006-10-13

> BS13701.3prime
ATGGTCTAGAAAGCTTCTACTGCCGTCCATAGACGTTCTCATCGGTATAG
GAAATGTAGAGGAAGTAGTCCTTGTCGAAGTGCTCCTGGTACAGTGCACC
CATGGTGGCCGATGTCGGTGGGATCACATTGTTTACGAAGAAGAAGAGGG
CGTCGTCGGGACGCAGATTGATACGCTTGCGGATGAGAAAGTAGAACTGG
CCCACTGTCAGGTCCGCCGGCACCAGGTACTTCTTCTTGTCCAGCTCCGC
GTAACGCGTCTTCGGCGCCTTTTCCACGATGACGGGCACACGGTCCGGAT
ACTTGCGCCGGATCTTGTCGCCTTCGTTGCGGCGCTTGTCGAACGAGTGG
TCCTTCTTGTACTGGTAGTTCATATCCATGTCGACTGATAACT

BS13701.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG12334-PA 363 Atg8b-RA 1..363 379..17 1815 100 Minus
CG32672-PA 366 Atg8a-RA 52..98 322..276 160 93.6 Minus
CG32672-PA 366 Atg8a-RA 175..275 199..99 155 86.1 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 10:09:17
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8b-RB 654 CG12334-RB 154..517 379..16 1820 100 Minus
Atg8b-RA 609 CG12334-RA 135..498 379..16 1820 100 Minus
Atg8a-RA 1214 CG32672-RA 269..606 373..36 775 82 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 10:09:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17724547..17724910 16..379 1820 100 Plus
X 23542271 X 10765604..10765802 85..283 470 82.4 Plus
X 23542271 X 10767979..10768070 282..373 235 83.7 Plus
Blast to na_te.dros performed on 2015-01-31 10:09:14 has no hits.

BS13701.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:42:59 Download gff for BS13701.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12334-PA 1..363 17..379 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 23:34:00 Download gff for BS13701.3prime
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 126..506 8..388 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 12:43:34 Download gff for BS13701.3prime
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 126..506 8..388 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 12:43:34 Download gff for BS13701.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 17724539..17724919 8..388 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 23:34:00 Download gff for BS13701.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13550261..13550641 8..388 97   Plus

BS13701.complete Sequence

395 bp assembled on 2006-11-01

GenBank Submission: FJ637504

> BS13701.complete
GAAGTTATCAGTCGACATGGATATGAACTACCAGTACAAGAAGGACCACT
CGTTCGACAAGCGCCGCAACGAAGGCGACAAGATCCGGCGCAAGTATCCG
GACCGTGTGCCCGTCATCGTGGAAAAGGCGCCGAAGACGCGTTACGCGGA
GCTGGACAAGAAGAAGTACCTGGTGCCGGCGGACCTGACAGTGGGCCAGT
TCTACTTTCTCATCCGCAAGCGTATCAATCTGCGTCCCGACGACGCCCTC
TTCTTCTTCGTAAACAATGTGATCCCACCGACATCGGCCACCATGGGTGC
ACTGTACCAGGAGCACTTCGACAAGGACTACTTCCTCTACATTTCCTATA
CCGATGAGAACGTCTATGGACGGCAGTAGAAGCTTTCTAGACCAT

BS13701.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8b-RB 363 CG12334-PB 1..363 17..379 1815 100 Plus
Atg8b-RA 363 CG12334-PA 1..363 17..379 1815 100 Plus
Atg8a-RA 366 CG32672-PA 1..338 23..360 775 82 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8b-RB 654 CG12334-RB 154..517 17..380 1820 100 Plus
Atg8b-RA 609 CG12334-RA 135..498 17..380 1820 100 Plus
Atg8a-RA 1214 CG32672-RA 269..606 23..360 775 82 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17724547..17724910 380..17 1820 100 Minus
X 23542271 X 10765604..10765802 311..113 470 82.4 Minus
X 23542271 X 10767979..10768070 114..23 235 83.7 Minus
Blast to na_te.dros performed on 2014-11-27 13:41:03 has no hits.

BS13701.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:39:16 Download gff for BS13701.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 1..363 17..379 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:12:42 Download gff for BS13701.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 126..506 8..388 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:31:55 Download gff for BS13701.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 135..497 17..379 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:39:16 Download gff for BS13701.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 126..506 8..388 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:24:13 Download gff for BS13701.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 135..497 17..379 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:24:13 Download gff for BS13701.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17724548..17724910 17..379 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:31:55 Download gff for BS13701.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13550270..13550632 17..379 100   Minus

BS13701.pep Sequence

Translation from 16 to 378

> BS13701.pep
MDMNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKK
YLVPADLTVGQFYFLIRKRINLRPDDALFFFVNNVIPPTSATMGALYQEH
FDKDYFLYISYTDENVYGRQ*

BS13701.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:14:27
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8b-PB 120 CG12334-PB 1..120 1..120 641 100 Plus
Atg8b-PA 120 CG12334-PA 1..120 1..120 641 100 Plus
Atg8a-PA 121 CG32672-PA 1..116 3..118 530 82.8 Plus
Atg8a-PC 107 CG32672-PC 7..102 23..118 401 78.1 Plus
Atg8a-PB 96 CG32672-PB 6..91 33..118 395 84.9 Plus