Clone BS13877 Report

Search the DGRC for BS13877

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:138
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptCG12279-RA
Protein status:BS13877.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS13877.3prime Sequence

363 bp (363 high quality bases) assembled on 2006-10-13

> BS13877.3prime
ATGGTCTAGAAAGCTTTTAGGACTGCTTGGCCTGCCACTCCGTCCATGAT
CCGGCATAAGCCTTGGCGTTGGTGAAGCCCAGCGTGCTGGCCAGATTGGC
CGCCCGGGCAGCGCGTCCTCCCGCCTTGCACGAGAAGATCAAGACCGCAT
CGACGGCCGGCTTGACGCGTCCATAAGTCTGGGCGAAGTCCTCCTCCGGC
AAGTTCAGTGCCTTCTCCAGCTCGCTCAGTGGAATGTTTATGCTGGCGGG
CAGGACGCCCGTCTCCTTCAGCTCCGACTCGTTGCGCACATCGAACAGGT
ACTTCTCCGGGTGGTTTGGAATGTCCTTGACTTCCTCGTAGGTGGCCATG
TCGACTGATAACT

BS13877.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG12279-PA 333 CG12279-RA 1..333 349..17 1665 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:47:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12279-RA 601 CG12279-RA 68..402 349..15 1675 100 Minus
mus308-RA 6420 CG6019-RA 6324..6377 15..68 270 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:47:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12705338..12705503 234..69 815 99.4 Minus
3R 32079331 3R 12705161..12705281 349..229 605 100 Minus
3R 32079331 3R 12705566..12705619 68..15 270 100 Minus
Blast to na_te.dros performed on 2015-02-12 17:47:58 has no hits.

BS13877.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:45:13 Download gff for BS13877.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12279-PA 1..333 17..349 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:42:31 Download gff for BS13877.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 68..409 6..349 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:48:07 Download gff for BS13877.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 68..409 6..349 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:48:07 Download gff for BS13877.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 12705344..12705503 69..228 100 -> Minus
3R 12705566..12705626 6..68 95   Minus
3R 12705163..12705281 229..347 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:42:31 Download gff for BS13877.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8530885..8531003 229..347 100 -> Minus
arm_3R 8531066..8531225 69..228 100 -> Minus
arm_3R 8531288..8531348 6..68 95   Minus

BS13877.5prime Sequence

363 bp (363 high quality bases) assembled on 2006-10-13

> BS13877.5prime
GAAGTTATCAGTCGACATGGCCACCTACGAGGAAGTCAAGGACATTCCAA
ACCACCCGGAGAAGTACCTGTTCGATGTGCGCAACGAGTCGGAGCTGAAG
GAGACGGGCGTCCTGCCCGCCAGCATAAACATTCCACTGAGCGAGCTGGA
GAAGGCACTGAACTTGCCGGAGGAGGACTTCGCCCAGACTTATGGACGCG
TCAAGCCGGCCGTCGATGCGGTCTTGATCTTCTCGTGCAAGGCGGGAGGA
CGCGCTGCCCGGGCGGCCAATCTGGCCAGCACGCTGGGCTTCACCAACGC
CAAGGCTTATGCCGGATCATGGACGGAGTGGCAGGCCAAGCAGTCCTAAA
AGCTTTCTAGACC

BS13877.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG12279-PA 333 CG12279-RA 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG12279-RA 601 CG12279-RA 68..402 17..351 1675 100 Plus
mus308-RA 6420 CG6019-RA 6324..6377 351..298 270 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 12:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12705338..12705503 132..297 815 99.4 Plus
3R 32079331 3R 12705161..12705281 17..137 605 100 Plus
3R 32079331 3R 12705566..12705619 298..351 270 100 Plus
Blast to na_te.dros performed on 2015-02-08 12:01:54 has no hits.

BS13877.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:45:14 Download gff for BS13877.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12279-PA 1..333 17..349 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:39:07 Download gff for BS13877.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 68..411 17..363 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:43:57 Download gff for BS13877.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 68..411 17..363 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:43:57 Download gff for BS13877.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 12705163..12705281 19..137 100 -> Plus
3R 12705344..12705503 138..297 100 -> Plus
3R 12705566..12705628 298..363 92   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:39:07 Download gff for BS13877.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8530885..8531003 19..137 100 -> Plus
arm_3R 8531066..8531225 138..297 100 -> Plus
arm_3R 8531288..8531350 298..363 92   Plus

BS13877.complete Sequence

365 bp assembled on 2006-11-01

GenBank Submission: FJ637544

> BS13877.complete
GAAGTTATCAGTCGACATGGCCACCTACGAGGAAGTCAAGGACATTCCAA
ACCACCCGGAGAAGTACCTGTTCGATGTGCGCAACGAGTCGGAGCTGAAG
GAGACGGGCGTCCTGCCCGCCAGCATAAACATTCCACTGAGCGAGCTGGA
GAAGGCACTGAACTTGCCGGAGGAGGACTTCGCCCAGACTTATGGACGCG
TCAAGCCGGCCGTCGATGCGGTCTTGATCTTCTCGTGCAAGGCGGGAGGA
CGCGCTGCCCGGGCGGCCAATCTGGCCAGCACGCTGGGCTTCACCAACGC
CAAGGCTTATGCCGGATCATGGACGGAGTGGCAGGCCAAGCAGTCCTAAA
AGCTTTCTAGACCAT

BS13877.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG12279-RA 333 CG12279-PA 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG12279-RA 601 CG12279-RA 68..402 17..351 1675 100 Plus
mus308-RA 6420 CG6019-RA 6324..6377 351..298 270 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12705338..12705503 132..297 815 99.4 Plus
3R 32079331 3R 12705161..12705281 17..137 605 100 Plus
3R 32079331 3R 12705566..12705619 298..351 270 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:02:30 has no hits.

BS13877.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:38:52 Download gff for BS13877.complete
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 1..333 17..349 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:12:13 Download gff for BS13877.complete
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 68..409 17..360 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:48:09 Download gff for BS13877.complete
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 68..398 17..347 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:38:52 Download gff for BS13877.complete
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 68..409 17..360 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:09:00 Download gff for BS13877.complete
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 68..398 17..347 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:09:00 Download gff for BS13877.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12705161..12705281 17..137 100 -> Plus
3R 12705344..12705503 138..297 100 -> Plus
3R 12705566..12705615 298..347 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:48:09 Download gff for BS13877.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8530883..8531003 17..137 100 -> Plus
arm_3R 8531066..8531225 138..297 100 -> Plus
arm_3R 8531288..8531337 298..347 100   Plus

BS13877.pep Sequence

Translation from 16 to 348

> BS13877.pep
MATYEEVKDIPNHPEKYLFDVRNESELKETGVLPASINIPLSELEKALNL
PEEDFAQTYGRVKPAVDAVLIFSCKAGGRAARAANLASTLGFTNAKAYAG
SWTEWQAKQS*

BS13877.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG12279-PA 110 CG12279-PA 1..110 1..110 566 100 Plus
Hsp67Bb-PD 111 CG4456-PD 1..109 1..109 326 53.2 Plus
Hsp67Bb-PC 111 CG4456-PC 1..109 1..109 326 53.2 Plus
Hsp67Bb-PB 111 CG4456-PB 1..109 1..109 326 53.2 Plus
Hsp67Bb-PA 111 CG4456-PA 1..109 1..109 326 53.2 Plus