Clone BS13921 Report

Search the DGRC for BS13921

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:139
Well:21
Vector:pDNR-Dual
Associated Gene/TranscriptCG32160-RA
Protein status:BS13921.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS13921.5prime Sequence

381 bp (381 high quality bases) assembled on 2006-10-13

> BS13921.5prime
GAAGTTATCAGTCGACATGGCGATTGCGCAGGCGCGCAGGTCACTCATAC
GCCATGGACGCAGTGGTGGCGGCAAAAAGGGGATTAAGATATATATGATG
ATTTTCCTGACTAACCACTTTAGATCTTTGGCTACTTGGTTGTCACCTTA
CATCCCGTTTTTAATGATCCCCTCTAATATTTTTTGCATTTGCCACTGCT
TGCAAGTGACAAACACAACTGTACCTTCAATGGTGTTCAACTGTAGTTGT
ATTTACCGCCGTTATGGTGATTTGTCAGCAATTTTTAGCATGATTAATGA
ATGTTTCAATCCGGCGACACAACTCCCTCTTCCTCCAACCCACCGCTTTG
TTAGCCGAAATTCTTGAAAGCTTTCTAGACC

BS13921.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG32160-PA 351 CG32160-RA 1..351 17..367 1730 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed on 2015-02-02 18:18:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 18:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16310066..16310416 17..367 1740 99.7 Plus
Blast to na_te.dros performed 2015-02-02 18:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 2275..2348 190..118 115 63.5 Minus

BS13921.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:45:41 Download gff for BS13921.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32160-PA 1..351 17..367 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 19:14:43 Download gff for BS13921.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 16310061..16310426 9..377 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 19:14:43 Download gff for BS13921.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 16310061..16310426 9..377 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 15:42:10 Download gff for BS13921.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16303161..16303526 9..377 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 15:42:10 Download gff for BS13921.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16303161..16303526 9..377 97   Plus

BS13921.3prime Sequence

381 bp (381 high quality bases) assembled on 2006-10-13

> BS13921.3prime
ATGGTCTAGAAAGCTTTCAAGAATTTCGGCTAACAAAGCGGTGGGTTGGA
GGAAGAGGGAGTTGTGTCGCCGGATTGAAACATTCATTAATCATGCTAAA
AATTGCTGACAAATCACCATAACGGCGGTAAATACAACTACAGTTGAACA
CCATTGAAGGTACAGTTGTGTTTGTCACTTGCAAGCAGTGGCAAATGCAA
AAAATATTAGAGGGGATCATTAAAAACGGGATGTAAGGTGACAACCAAGT
AGCCAAAGATCTAAAGTGGTTAGTCAGGAAAATCATCATATATATCTTAA
TCCCCTTTTTGCCGCCACCACTGCGTCCATGGCGTATGAGTGACCTGCGC
GCCTGCGCAATCGCCATGTCGACTGATAACT

BS13921.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG32160-PA 351 CG32160-RA 1..351 367..17 1730 99.7 Minus
Blast to dmel-all-transcript-r6.02.fasta performed on 2015-02-10 17:51:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16310066..16310416 367..17 1740 99.7 Minus
Blast to na_te.dros performed 2015-02-10 17:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 2275..2348 194..266 115 63.5 Plus

BS13921.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:45:41 Download gff for BS13921.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32160-PA 1..351 17..367 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 19:01:20 Download gff for BS13921.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 16310061..16310426 7..375 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 19:01:20 Download gff for BS13921.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 16310061..16310426 7..375 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:43:10 Download gff for BS13921.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16303161..16303526 7..375 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:43:10 Download gff for BS13921.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16303161..16303526 7..375 97   Minus

BS13921.complete Sequence

383 bp assembled on 2006-11-01

GenBank Submission: FJ637554

> BS13921.complete
GAAGTTATCAGTCGACATGGCGATTGCGCAGGCGCGCAGGTCACTCATAC
GCCATGGACGCAGTGGTGGCGGCAAAAAGGGGATTAAGATATATATGATG
ATTTTCCTGACTAACCACTTTAGATCTTTGGCTACTTGGTTGTCACCTTA
CATCCCGTTTTTAATGATCCCCTCTAATATTTTTTGCATTTGCCACTGCT
TGCAAGTGACAAACACAACTGTACCTTCAATGGTGTTCAACTGTAGTTGT
ATTTACCGCCGTTATGGTGATTTGTCAGCAATTTTTAGCATGATTAATGA
ATGTTTCAATCCGGCGACACAACTCCCTCTTCCTCCAACCCACCGCTTTG
TTAGCCGAAATTCTTGAAAGCTTTCTAGACCAT

BS13921.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 13:43:16 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-27 13:43:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16310066..16310416 17..367 1740 99.7 Plus
Blast to na_te.dros performed 2014-11-27 13:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 2275..2348 190..118 115 63.5 Minus

BS13921.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:45:26 Download gff for BS13921.complete
Subject Subject Range Query Range Percent Splice Strand
CG32160-RA 1..351 17..367 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:31:21 Download gff for BS13921.complete
Subject Subject Range Query Range Percent Splice Strand
CG32160-RA 881..1246 9..377 97   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:45:26 Download gff for BS13921.complete
Subject Subject Range Query Range Percent Splice Strand
CG32160-RA 881..1246 9..377 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:54:25 Download gff for BS13921.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16310066..16310415 17..366 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:54:25 Download gff for BS13921.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16310066..16310415 17..366 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:23:06 Download gff for BS13921.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16303166..16303515 17..366 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:23:06 Download gff for BS13921.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16303166..16303515 17..366 99   Plus

BS13921.pep Sequence

Translation from 16 to 366

> BS13921.pep
MAIAQARRSLIRHGRSGGGKKGIKIYMMIFLTNHFRSLATWLSPYIPFLM
IPSNIFCICHCLQVTNTTVPSMVFNCSCIYRRYGDLSAIFSMINECFNPA
TQLPLPPTHRFVSRNS*
Sequence BS13921.pep has no blast hits.