Clone BS13992 Report

Search the DGRC for BS13992

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:139
Well:92
Vector:pDNR-Dual
Associated Gene/TranscriptATPsyn-d-RA
Protein status:BS13992.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS13992.3prime Sequence

567 bp (509 high quality bases) assembled on 2006-10-13

> BS13992.3prime
ATGGTCTAGAAAGCTTTTAGTGGTGTCCCTGGGCTTCGGCCTCCAGCTGC
TCCTTGGACTTGTAGCCGACCTGCTCCTCGGGAGTGTGGGGCCAGAAGGT
AGGCTTGTTGAGGGGATCGAGTGCGCTATCGGGGAATGCGTCGCGGTAGT
CCTCCATGGTCATCTGGTCGTAGGGCAGCAGAGACTTGAGATGGGCGATC
TCCTTTTGGTAGTTCTGAATGCGCTGCTCCGAGGCCTTCTTGTAGGCATC
GATTTCGCTCTGCGACGCCTTGATCTCGGCATCCACCTGGGACGACACCT
TGTCCTGGGGATAGGGCACCTTCAGGGCTTCGTACTGCTTCTGGAAGCTA
TCGACGAGTCCGGCCACTGGCACAAGCTTCTTGTAGTTGGCCCAATCGAT
CTGGGGTGGGCACTCGGGATTGGCCAGCACGGCGCGCACATAGATGTCCG
ACTTGGTCTTGAAGGCGCCGAAGCTGCTCTTCTGGTTGGCGGGCACGCGC
TCGGCGAGAGCGGACCAGTTGATCGAGGATTGGGCGATACGGCGGGCGGC
CTTGTCAACTGATAACT

BS13992.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG6030-PB 537 ATPsyn-d-RB 3..537 551..17 2650 99.8 Minus
CG6030-PA 537 ATPsyn-d-RA 3..537 551..17 2650 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsyn-d-RC 950 CG6030-RC 90..625 551..16 2665 99.8 Minus
ATPsyn-d-RA 734 CG6030-RA 90..625 551..16 2665 99.8 Minus
ATPsyn-d-RB 694 CG6030-RB 37..572 551..16 2665 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 12:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19095411..19095946 551..16 2665 99.8 Minus
Blast to na_te.dros performed on 2015-02-08 12:07:26 has no hits.

BS13992.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:46:33 Download gff for BS13992.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6030-PA 1..537 17..552 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:39:58 Download gff for BS13992.3prime
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RB 46..585 16..556 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:44:42 Download gff for BS13992.3prime
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RB 33..572 16..556 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:44:42 Download gff for BS13992.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 19095407..19095946 16..556 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:39:58 Download gff for BS13992.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14921129..14921668 16..556 99   Minus

BS13992.5prime Sequence

541 bp (490 high quality bases) assembled on 2006-10-13

> BS13992.5prime
GAAGTTATCAGTCGACATGGCCGCCCGCCGTATCGCCCAATCCTCGATCA
ACTGGTCCGCTCTCGCCGAGCGCGTGCCCGCCAACCAGAAGAGCAGCTTC
GGCGCCTTCAAGACCAAGTCGGACATCTATGTGCGCGCCGTGCTGGCCAA
TCCCGAGTGCCCACCCCAGATCGATTGGGCCAACTACAAGAAGCTTGTGC
CAGTGGCCGGACTCGTCGATAGCTTCCAGAAGCAGTACGAAGCCCTGAAG
GTGCCCTATCCCCAGGACAAGGTGTCGTCCCAGGTGGATGCCGAGATCAA
GGCGTCGCAGAGCGAAATCGATGCCTACAAGAAGGCCTCGGAGCAGCGCA
TTCAGAACTACCAAAAGGAGATCGCCCATCTCAAGTCTCTGCTGCCCTAC
GACCAGATGACCATGGAGGACTACCGCGACGCATTCCCCGATAGCGCACT
CGATCCCCTCAACAAGCCTACCTTCTGGCCCCACACTCCCGAGGAGCAGG
TCGGCTACAAGTCCCAGGAGCAGCTGGAGGCCGAAGCCCAG

BS13992.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG6030-PB 537 ATPsyn-d-RB 1..525 17..541 2575 99.6 Plus
CG6030-PA 537 ATPsyn-d-RA 1..525 17..541 2575 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 10:30:51
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsyn-d-RC 950 CG6030-RC 88..612 17..541 2595 99.6 Plus
ATPsyn-d-RA 734 CG6030-RA 88..612 17..541 2595 99.6 Plus
ATPsyn-d-RB 694 CG6030-RB 35..559 17..541 2595 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 10:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19095409..19095933 17..541 2595 99.6 Plus
Blast to na_te.dros performed on 2015-02-06 10:30:47 has no hits.

BS13992.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:46:34 Download gff for BS13992.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6030-PA 1..525 17..541 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 06:42:24 Download gff for BS13992.5prime
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RB 32..572 2..541 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:26:59 Download gff for BS13992.5prime
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RB 19..559 2..541 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:26:59 Download gff for BS13992.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 19095397..19095933 6..541 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:42:24 Download gff for BS13992.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14921119..14921655 6..541 98   Plus

BS13992.complete Sequence

569 bp assembled on 2006-11-01

GenBank Submission: FJ637576

> BS13992.complete
GAAGTTATCAGTCGACATGGCCGCCCGCCGTATCGCCCAATCCTCGATCA
ACTGGTCCGCTCTCGCCGAGCGCGTGCCCGCCAACCAGAAGAGCAGCTTC
GGCGCCTTCAAGACCAAGTCGGACATCTATGTGCGCGCCGTGCTGGCCAA
TCCCGAGTGCCCACCCCAGATCGATTGGGCCAACTACAAGAAGCTTGTGC
CAGTGGCCGGACTCGTCGATAGCTTCCAGAAGCAGTACGAAGCCCTGAAG
GTGCCCTATCCCCAGGACAAGGTGTCGTCCCAGGTGGATGCCGAGATCAA
GGCGTCGCAGAGCGAAATCGATGCCTACAAGAAGGCCTCGGAGCAGCGCA
TTCAGAACTACCAAAAGGAGATCGCCCATCTCAAGTCTCTGCTGCCCTAC
GACCAGATGACCATGGAGGACTACCGCGACGCATTCCCCGATAGCGCACT
CGATCCCCTCAACAAGCCTACCTTCTGGCCCCACACTCCCGAGGAGCAGG
TCGGCTACAAGTCCAAGGAGCAGCTGGAGGCCGAAGCCCAGGGACACCAC
TAAAAGCTTTCTAGACCAT

BS13992.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsyn-d-RC 537 CG6030-PC 1..537 17..553 2670 99.8 Plus
ATPsyn-d-RA 537 CG6030-PA 1..537 17..553 2670 99.8 Plus
ATPsyn-d-RB 537 CG6030-PB 1..537 17..553 2670 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsyn-d-RC 950 CG6030-RC 88..625 17..554 2675 99.8 Plus
ATPsyn-d-RA 734 CG6030-RA 88..625 17..554 2675 99.8 Plus
ATPsyn-d-RB 694 CG6030-RB 35..572 17..554 2675 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19095409..19095946 17..554 2675 99.8 Plus
Blast to na_te.dros performed on 2014-11-27 01:05:27 has no hits.

BS13992.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:38:25 Download gff for BS13992.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RA 1..537 17..553 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:11:45 Download gff for BS13992.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RA 66..615 6..554 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:44:40 Download gff for BS13992.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RB 48..582 17..551 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:38:25 Download gff for BS13992.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RA 66..615 6..554 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:18:15 Download gff for BS13992.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RB 35..569 17..551 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:18:15 Download gff for BS13992.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19095409..19095943 17..551 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:44:40 Download gff for BS13992.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14921131..14921665 17..551 99   Plus

BS13992.pep Sequence

Translation from 16 to 552

> BS13992.pep
MAARRIAQSSINWSALAERVPANQKSSFGAFKTKSDIYVRAVLANPECPP
QIDWANYKKLVPVAGLVDSFQKQYEALKVPYPQDKVSSQVDAEIKASQSE
IDAYKKASEQRIQNYQKEIAHLKSLLPYDQMTMEDYRDAFPDSALDPLNK
PTFWPHTPEEQVGYKSKEQLEAEAQGHH*

BS13992.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsyn-d-PC 178 CG6030-PC 1..178 1..178 929 100 Plus
ATPsyn-d-PA 178 CG6030-PA 1..178 1..178 929 100 Plus
ATPsyn-d-PB 178 CG6030-PB 1..178 1..178 929 100 Plus
CG7813-PA 734 CG7813-PA 19..200 4..178 241 33.7 Plus