Clone BS14021 Report

Search the DGRC for BS14021

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:140
Well:21
Vector:pDNR-Dual
Associated Gene/TranscriptCG11858-RA
Protein status:BS14021.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS14021.5prime Sequence

423 bp (423 high quality bases) assembled on 2006-10-13

> BS14021.5prime
GAAGTTATCAGTCGACATGCCACCGAAAAAGGATGCGAAGAGTGGAAAGG
ATGCAGGGAAAGGTGGCAAAAAGCCAGCCGCCGAAGACAAGTCTGCCGGT
AAGGAGAAGAAGGGAGGCAATGCTGTAAAGGTTCGTCACATCTTGTGCGA
GAAGCAGGGCAAGATCACCGAAGCGATGGAGAAGCTAAAGGCAGGCCAAA
AATTCCCCGAGGTAGCGGCTGCTTACAGCGAGGACAAGGCGCGACAAGGC
GGCGATCTCGGATGGCAGATCCGAGGAGCGATGGTGGGCCCATTTCAGGA
CGCCGCCTTCGCATTGCCCATCTCCACTGTCAACAATCCCGTGTACACAG
ATCCCCCGATTAAGACCAAGTTTGGCTACCACATCATCATGGTGGAGGGA
AAGAAATGAAAGCTTTCTAGACC

BS14021.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG11858-PA 393 CG11858-RA 1..393 17..409 1965 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG11858-RA 493 CG11858-RA 70..463 17..410 1970 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25262945..25263262 93..410 1590 100 Plus
3R 32079331 3R 25262810..25262885 17..92 380 100 Plus
Blast to na_te.dros performed on 2015-02-10 17:08:52 has no hits.

BS14021.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:46:52 Download gff for BS14021.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11858-PA 1..393 17..409 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:23:29 Download gff for BS14021.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 70..467 17..416 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:07:24 Download gff for BS14021.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 70..467 17..416 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:07:24 Download gff for BS14021.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 25262810..25262885 17..92 100 -> Plus
3R 25262945..25263266 93..416 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:23:29 Download gff for BS14021.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21088532..21088607 17..92 100 -> Plus
arm_3R 21088667..21088988 93..416 99   Plus

BS14021.complete Sequence

425 bp assembled on 2006-11-01

GenBank Submission: FJ637584

> BS14021.complete
GAAGTTATCAGTCGACATGCCACCGAAAAAGGATGCGAAGAGTGGAAAGG
ATGCAGGGAAAGGTGGCAAAAAGCCAGCCGCCGAAGACAAGTCTGCCGGT
AAGGAGAAGAAGGGAGGCAATGCTGTAAAGGTTCGTCACATCTTGTGCGA
GAAGCAGGGCAAGATCACCGAAGCGATGGAGAAGCTAAAGGCAGGCCAAA
AATTCCCCGAGGTAGCGGCTGCTTACAGCGAGGACAAGGCGCGACAAGGC
GGCGATCTCGGATGGCAGATCCGAGGAGCGATGGTGGGCCCATTTCAGGA
CGCCGCCTTCGCATTGCCCATCTCCACTGTCAACAATCCCGTGTACACAG
ATCCCCCGATTAAGACCAAGTTTGGCTACCACATCATCATGGTGGAGGGA
AAGAAATGAAAGCTTTCTAGACCAT

BS14021.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG11858-RA 393 CG11858-PA 1..393 17..409 1965 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:53:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG11858-RA 493 CG11858-RA 70..463 17..410 1970 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:53:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25262945..25263262 93..410 1590 100 Plus
3R 32079331 3R 25262810..25262885 17..92 380 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:53:32 has no hits.

BS14021.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:38:10 Download gff for BS14021.complete
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 1..393 17..409 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:11:27 Download gff for BS14021.complete
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 68..465 17..416 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:01:46 Download gff for BS14021.complete
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 70..461 17..408 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:38:10 Download gff for BS14021.complete
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 68..465 17..416 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:28:31 Download gff for BS14021.complete
Subject Subject Range Query Range Percent Splice Strand
CG11858-RA 70..461 17..408 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:28:31 Download gff for BS14021.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25262810..25262885 17..92 100 -> Plus
3R 25262945..25263260 93..408 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:01:46 Download gff for BS14021.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21088532..21088607 17..92 100 -> Plus
arm_3R 21088667..21088982 93..408 100   Plus

BS14021.pep Sequence

Translation from 16 to 408

> BS14021.pep
MPPKKDAKSGKDAGKGGKKPAAEDKSAGKEKKGGNAVKVRHILCEKQGKI
TEAMEKLKAGQKFPEVAAAYSEDKARQGGDLGWQIRGAMVGPFQDAAFAL
PISTVNNPVYTDPPIKTKFGYHIIMVEGKK*

BS14021.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG11858-PA 130 CG11858-PA 1..130 1..130 682 100 Plus