Clone BS14035 Report

Search the DGRC for BS14035

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:140
Well:35
Vector:pDNR-Dual
Associated Gene/TranscriptEloC-RA
Protein status:BS14035.pep: full length peptide match
Sequenced Size:386

Clone Sequence Records

BS14035.complete Sequence

386 bp assembled on 2010-02-09

GenBank Submission: KX806443

> BS14035.complete
GAAGTTATCAGTCGACATGATAGCAATGGACGAGCAGCGCGGCGACAAGA
TCTACGGCGGATGCGAGGGTCCGGACGCCATGTACGTGAAGCTGATTTCC
TCGGACGGCCACGAATTTGTCGTCAAACGCGAGCACGCTCTCACCTCCGG
CACAATCCGGGCGATGTTGTCCGGACCGGGTCAGTTTGCCGAGAACGAGG
CCAACGAGGTGCATTTCCGGGAGATACCATCCCACGTCCTACAAAAGGTC
TGCATGTACTTCACCTATAAAGTGCGTTACACCAACAGTTCTACCGAAAT
ACCCGAATTCCCGATCGCTCCGGAGATCGCATTAGAACTTTTGATGGCGG
CTAATTTCCTAGACTGCTAAAAGCTTTCTAGACCAT

BS14035.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
EloC-RB 354 CG9291-PB 1..354 17..370 1770 100 Plus
EloC-RA 354 CG9291-PA 1..354 17..370 1770 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
EloC-RB 654 CG9291-RB 148..502 17..371 1775 100 Plus
EloC-RA 576 CG9291-RA 70..424 17..371 1775 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19445928..19446139 228..17 1060 100 Minus
2R 25286936 2R 19445237..19445379 371..229 715 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:23:17 has no hits.

BS14035.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:16:01 Download gff for BS14035.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-C-RB 1..354 17..370 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:09:42 Download gff for BS14035.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-C-RA 60..411 17..368 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:58:13 Download gff for BS14035.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-C-RA 70..421 17..368 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:37:05 Download gff for BS14035.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-C-RA 60..411 17..368 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:27:23 Download gff for BS14035.complete
Subject Subject Range Query Range Percent Splice Strand
EloC-RA 70..421 17..368 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:27:23 Download gff for BS14035.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19445240..19445379 229..368 100 <- Minus
2R 19445928..19446139 17..228 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:58:13 Download gff for BS14035.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15332745..15332884 229..368 100 <- Minus
arm_2R 15333433..15333644 17..228 100   Minus

BS14035.5prime Sequence

384 bp (384 high quality bases) assembled on 2006-10-13

> BS14035.5prime
GAAGTTATCAGTCGACATGATAGCAATGGACGAGCAGCGCGGCGACAAGA
TCTACGGCGGATGCGAGGGTCCGGACGCCATGTACGTGAAGCTGATTTCC
TCGGACGGCCACGAATTTGTCGTCAAACGCGAGCACGCTCTCACCTCCGG
CACAATCCGGGCGATGTTGTCCGGACCGGGTCAGTTTGCCGAGAACGAGG
CCAACGAGGTGCATTTCCGGGAGATACCATCCCACGTCCTACAAAAGGTC
TGCATGTACTTCACCTATAAAGTGCGTTACACCAACAGTTCTACCGAAAT
ACCCGAATTCCCGATCGCTCCGGAGATCGCATTAGAACTTTTGATGGCGG
CTAATTTCCTAGACTGCTAAAAGCTTTCTAGACC

BS14035.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG9291-PA 354 Elongin-C-RA 1..354 17..370 1770 100 Plus
CG9291-PB 354 Elongin-C-RB 1..354 17..370 1770 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
EloC-RB 654 CG9291-RB 148..502 17..371 1775 100 Plus
EloC-RA 576 CG9291-RA 70..424 17..371 1775 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19445928..19446139 228..17 1060 100 Minus
2R 25286936 2R 19445237..19445379 371..229 715 100 Minus
Blast to na_te.dros performed on 2015-02-13 16:24:43 has no hits.

BS14035.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:47:02 Download gff for BS14035.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9291-PB 1..354 17..370 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 12:50:51 Download gff for BS14035.5prime
Subject Subject Range Query Range Percent Splice Strand
Elongin-C-RA 70..424 17..371 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:54:15 Download gff for BS14035.5prime
Subject Subject Range Query Range Percent Splice Strand
EloC-RA 70..424 17..371 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:54:15 Download gff for BS14035.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 19445237..19445379 229..371 100 <- Minus
2R 19445928..19446143 12..228 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 12:50:51 Download gff for BS14035.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15332742..15332884 229..371 100 <- Minus
arm_2R 15333433..15333648 12..228 99   Minus

BS14035.pep Sequence

Translation from 16 to 369

> BS14035.pep
MIAMDEQRGDKIYGGCEGPDAMYVKLISSDGHEFVVKREHALTSGTIRAM
LSGPGQFAENEANEVHFREIPSHVLQKVCMYFTYKVRYTNSSTEIPEFPI
APEIALELLMAANFLDC*

BS14035.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 03:05:00
Subject Length Description Subject Range Query Range Score Percent Strand
EloC-PB 117 CG9291-PB 1..117 1..117 614 100 Plus
EloC-PA 117 CG9291-PA 1..117 1..117 614 100 Plus