Clone BS14141 Report

Search the DGRC for BS14141

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:141
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptLSm7-RA
Protein status:BS14141.pep: full length peptide match
Sequenced Size:365

Clone Sequence Records

BS14141.5prime Sequence

363 bp (363 high quality bases) assembled on 2006-10-13

> BS14141.5prime
GAAGTTATCAGTCGACATGGCAGATAAAAAGGTGGGTGGCAACAATGACG
GTAAGGAGAAGCGCCGCAAGGAGTCCATTCTGGACCTCTCCAAGTACTTG
GAGAAACAGATCCGCGTGAAATTCGCGGGCGGCCGCGAGGCATCCGGAAT
CCTCAAGGGCTACGATGCGCTGCTCAATCTGGTGCTGGACAACACGGTGG
AGTATCTGCGCGACTCGGATGAGCCCTACAAACTGACCGAGGAGCAGACC
CGCAGCCTGGGACTGGTCGTCTGTCGCGGCACAGCCCTCGTCCTCATTTG
TCCGCAAGACGGAGTCGAGAGCATCGCCAATCCGTTTATAACGCAATAGA
AGCTTTCTAGACC

BS14141.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG13277-PA 333 CG13277-RA 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
LSm7-RB 466 CG13277-RB 41..373 17..349 1665 100 Plus
LSm7-RC 544 CG13277-RC 41..373 17..349 1665 100 Plus
LSm7-RA 705 CG13277-RA 41..373 17..349 1665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16742669..16742988 349..30 1600 100 Minus
Blast to na_te.dros performed on 2015-02-13 16:27:10 has no hits.

BS14141.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:48:15 Download gff for BS14141.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13277-PA 1..333 17..349 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 12:51:50 Download gff for BS14141.5prime
Subject Subject Range Query Range Percent Splice Strand
LSm7-RA 34..383 9..356 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 19:00:57 Download gff for BS14141.5prime
Subject Subject Range Query Range Percent Splice Strand
LSm7-RA 34..383 9..356 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 19:00:57 Download gff for BS14141.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 16742659..16742986 32..356 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 12:51:50 Download gff for BS14141.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16742659..16742986 32..356 98 <- Minus

BS14141.complete Sequence

365 bp assembled on 2012-04-26

GenBank Submission: KX803256

> BS14141.complete
GAAGTTATCAGTCGACATGGCAGATAAAAAGGTGGGTGGCAACAATGACG
GTAAGGAGAAGCGCCGCAAGGAGTCCATTCTGGACCTCTCCAAGTACTTG
GAGAAACAGATCCGCGTGAAATTCGCGGGCGGCCGCGAGGCATCCGGAAT
CCTCAAGGGCTACGATGCGCTGCTCAATCTGGTGCTGGACAACACGGTGG
AGTATCTGCGCGACTCGGATGAGCCCTACAAACTGACCGAGGAGCAGACC
CGCAGCCTGGGACTGGTCGTCTGTCGCGGCACAGCCCTCGTCCTCATTTG
TCCGCAAGACGGAGTCGAGAGCATCGCCAATCCGTTTATAACGCAATAGA
AGCTTTCTAGACCAT

BS14141.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 12:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
LSm7-RB 333 CG13277-PB 1..333 17..349 1665 100 Plus
LSm7-RC 333 CG13277-PC 1..333 17..349 1665 100 Plus
LSm7-RA 333 CG13277-PA 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 12:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
LSm7-RB 466 CG13277-RB 41..373 17..349 1665 100 Plus
LSm7-RC 544 CG13277-RC 41..373 17..349 1665 100 Plus
LSm7-RA 705 CG13277-RA 41..373 17..349 1665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 12:28:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16742669..16742988 349..30 1600 100 Minus
Blast to na_te.dros performed on 2014-11-28 12:28:52 has no hits.

BS14141.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-26 12:45:46 Download gff for BS14141.complete
Subject Subject Range Query Range Percent Splice Strand
LSm7-RA 30..362 17..349 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:43:51 Download gff for BS14141.complete
Subject Subject Range Query Range Percent Splice Strand
LSm7-RA 41..373 17..349 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:05:11 Download gff for BS14141.complete
Subject Subject Range Query Range Percent Splice Strand
LSm7-RA 41..373 17..349 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 13:05:11 Download gff for BS14141.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16742669..16742986 32..349 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:43:51 Download gff for BS14141.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16742669..16742986 32..349 100 <- Minus

BS14141.pep Sequence

Translation from 16 to 348

> BS14141.pep
MADKKVGGNNDGKEKRRKESILDLSKYLEKQIRVKFAGGREASGILKGYD
ALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCRGTALVLICPQDGV
ESIANPFITQ*

BS14141.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
LSm7-PB 110 CG13277-PB 1..110 1..110 557 100 Plus
LSm7-PC 110 CG13277-PC 1..110 1..110 557 100 Plus
LSm7-PA 110 CG13277-PA 1..110 1..110 557 100 Plus
SmG-PB 76 CG9742-PB 8..76 23..100 142 35.9 Plus
SmG-PA 76 CG9742-PA 8..76 23..100 142 35.9 Plus