Clone BS14340 Report

Search the DGRC for BS14340

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:143
Well:40
Vector:pDNR-Dual
Associated Gene/TranscriptCG42336-RC
Protein status:BS14340.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS14340.3prime Sequence

409 bp (408 high quality bases) assembled on 2006-10-13

> BS14340.3prime
ATGGTCTAGAAAGCTTTCAGTTTGACTTCTTGGCCTTCTTCTGTTGCTTG
CTCTTCAGTTTCTCCTGCTTCTTGAGCTCCTTTTCCGTCAGGGATTTGTA
CAGCTTGTAGCCAAAGAGAGCGAATATGGAGACCAAGAGAAAGATCACTG
CCGACACTATGGAACTGGAGTAGGTCTGTGCGAAATGGGCGTGCTGCACT
ATTCGCTCCTCGATTCTGCCAATCGTCTGCTGGAACTTGTCCTTCATCTC
GGCGAGAAACACATGCCGATCCGTTTCGGCCAGGGACTCCAGCTTGCTCT
GCATCTCGCCGATCCGCTGGACGAGATCCTTGGAGAACTTGCTGCTGGGC
CCAGTTTTGGCCACGATCGACTCCACGGACTTTTTCAGCTGCTCAATAAC
CCCGAGCTC

BS14340.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG13211-PB 417 CG13211-RB 25..417 409..17 1965 100 Minus
CG13211-PA 198 CG13211-RA 94..198 121..17 525 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG42336-RC 747 CG42336-RC 209..602 409..16 1970 100 Minus
CG42336-RD 707 CG42336-RD 97..390 409..116 1455 99.7 Minus
CG42336-RD 707 CG42336-RD 457..562 121..16 530 100 Minus
CG42336-RF 901 CG42336-RF 651..756 121..16 530 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11294853..11295146 116..409 1455 99.7 Plus
2R 25286936 2R 11294681..11294786 16..121 530 100 Plus
Blast to na_te.dros performed on 2015-02-10 17:20:32 has no hits.

BS14340.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:50:28 Download gff for BS14340.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13211-PB 25..417 17..409 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:40:35 Download gff for BS14340.3prime
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 209..602 16..409 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:56:34 Download gff for BS14340.3prime
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 209..602 16..409 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:56:34 Download gff for BS14340.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 11294858..11295146 121..409 100   Plus
2R 11294681..11294785 16..120 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:40:35 Download gff for BS14340.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7182186..7182290 16..120 100 <- Plus
arm_2R 7182363..7182651 121..409 100   Plus

BS14340.5prime Sequence

449 bp (448 high quality bases) assembled on 2006-10-13

> BS14340.5prime
GAAGTTATCAGTCGACATGAGTTGGTCGGGTTCCAGTGACGAGCTCGGGG
TTATTGAGCAGCTGAAAAAGTCCGTGGAGTCGATCGTGGCCAAAACTGGG
CCCAGCAGCAAGTTCTCCAAGGATCTCGTCCAGCGGATCGGCGAGATGCA
GAGCAAGCTGGAGTCCCTGGCCGAAACGGATCGGCATGTGTTTCTCGCCG
AGATGAAGGACAAGTTCCAGCAGACGATTGGCAGAATCGAGGAGCGAATA
GTGCAGCACGCCCATTTCGCACAGACCTACTCCAGTTCCATAGTGTCGGC
AGTGATCTTTCTCTTGGTCTCCATATTCGCTCTCTTTGGCTACAAGCTGT
ACAAAATCCCTGACGGAAAAGGAGCTCAAGAAGCAGGAGAAACTGAAGAG
CCAGCCACAGAAAGAAGGCCAAGAAGTCAAACTGAAAGCTTTCTAGACC

BS14340.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG13211-PB 417 CG13211-RB 1..339 17..355 1695 100 Plus
CG13211-PB 417 CG13211-RB 337..395 354..412 245 96.6 Plus
CG13211-PA 198 CG13211-RA 118..176 354..412 245 96.6 Plus
CG13211-PA 198 CG13211-RA 94..120 329..355 135 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG42336-RC 747 CG42336-RC 183..602 15..436 2030 99.1 Plus
CG42336-RD 707 CG42336-RD 71..390 15..334 1585 99.7 Plus
CG42336-RD 707 CG42336-RD 457..562 329..436 460 96.3 Plus
CG42336-RF 901 CG42336-RF 651..756 329..436 460 96.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11294853..11295172 334..15 1585 99.7 Minus
2R 25286936 2R 11294681..11294786 436..329 410 96.3 Minus
Blast to na_te.dros performed on 2015-02-11 09:06:25 has no hits.

BS14340.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:50:28 Download gff for BS14340.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13211-PB 1..417 17..435 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 16:59:55 Download gff for BS14340.5prime
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 179..602 9..436 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:50:54 Download gff for BS14340.5prime
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 179..602 9..436 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 10:50:54 Download gff for BS14340.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 11294681..11294785 330..436 96 <- Minus
2R 11294858..11295176 9..329 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 16:59:55 Download gff for BS14340.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7182186..7182290 330..436 96 <- Minus
arm_2R 7182363..7182681 9..329 98   Minus

BS14340.complete Sequence

449 bp assembled on 2006-11-01

GenBank Submission: FJ637637

> BS14340.complete
GAAGTTATCAGTCGACATGAGTTGGTCGGGTTCCAGTGACGAGCTCGGGG
TTATTGAGCAGCTGAAAAAGTCCGTGGAGTCGATCGTGGCCAAAACTGGG
CCCAGCAGCAAGTTCTCCAAGGATCTCGTCCAGCGGATCGGCGAGATGCA
GAGCAAGCTGGAGTCCCTGGCCGAAACGGATCGGCATGTGTTTCTCGCCG
AGATGAAGGACAAGTTCCAGCAGACGATTGGCAGAATCGAGGAGCGAATA
GTGCAGCACGCCCATTTCGCACAGACCTACTCCAGTTCCATAGTGTCGGC
AGTGATCTTTCTCTTGGTCTCCATATTCGCTCTCTTTGGCTACAAGCTGT
ACAAATCCCTGACGGAAAAGGAGCTCAAGAAGCAGGAGAAACTGAAGAGC
AAGCAACAGAAGAAGGCCAAGAAGTCAAACTGAAAGCTTTCTAGACCAT

BS14340.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:18:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG42336-RC 417 CG42336-PC 1..417 17..433 2085 100 Plus
CG42336-RD 489 CG42336-PD 1..318 17..334 1575 99.7 Plus
CG42336-RD 489 CG42336-PD 385..489 329..433 525 100 Plus
CG42336-RF 423 CG42336-PF 319..423 329..433 525 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:18:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG42336-RC 747 CG42336-RC 183..602 15..434 2100 100 Plus
CG42336-RD 707 CG42336-RD 71..390 15..334 1585 99.7 Plus
CG42336-RD 707 CG42336-RD 457..562 329..434 530 100 Plus
CG42336-RF 901 CG42336-RF 651..756 329..434 530 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11294853..11295172 334..15 1585 99.7 Minus
2R 25286936 2R 11294681..11294786 434..329 530 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:18:00 has no hits.

BS14340.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:37:12 Download gff for BS14340.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 1..417 17..433 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:10:24 Download gff for BS14340.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 179..602 9..434 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:24:51 Download gff for BS14340.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 185..600 17..432 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:37:13 Download gff for BS14340.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 179..602 9..434 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:15:15 Download gff for BS14340.complete
Subject Subject Range Query Range Percent Splice Strand
CG42336-RC 185..600 17..432 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:15:15 Download gff for BS14340.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11294858..11295170 17..329 100   Minus
2R 11294683..11294785 330..432 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:24:51 Download gff for BS14340.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7182188..7182290 330..432 100 <- Minus
arm_2R 7182363..7182675 17..329 100   Minus

BS14340.pep Sequence

Translation from 16 to 432

> BS14340.pep
MSWSGSSDELGVIEQLKKSVESIVAKTGPSSKFSKDLVQRIGEMQSKLES
LAETDRHVFLAEMKDKFQQTIGRIEERIVQHAHFAQTYSSSIVSAVIFLL
VSIFALFGYKLYKSLTEKELKKQEKLKSKQQKKAKKSN*

BS14340.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG42336-PC 138 CG13211-PB 1..138 1..138 673 100 Plus
CG42336-PD 162 CG42336-PD 1..162 1..138 638 85.2 Plus
CG42336-PF 140 CG42336-PF 37..140 33..138 191 45.4 Plus
CG42336-PE 140 CG42336-PE 37..140 33..138 191 45.4 Plus
CG42336-PB 65 CG13211-PA 22..65 92..138 170 78.7 Plus