Clone Sequence Records
BS14447.3prime Sequence
255 bp (254 high quality bases) assembled on 2006-10-13
> BS14447.3prime
ATGGTCTAGAAAGCTTCTAGCAGTGATGATGATGATGTCCATGGTGAGGA
CCATGATGATGGTCAAAGTGGCTGCCGTGGTGATGATGATGATGATCGTA
GTGGGGCGGCGGTGGCGGAGGTCCGTAGTGGTGGTGGTGGTGCGGCGGGG
GTCCGTGGTGGTGCATTGGAGGTCCGTGGTGGTGATGGTGGTGCACCGGA
GGCGGTGGGTGATAGTGGTGCACCGGAGGCGGTGGATGATGGTGGTGGTG
ATGAT
BS14447.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:47:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13482-PA | 309 | CG13482-RA | 71..309 | 255..17 | 1195 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:40:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13482-RA | 540 | CG13482-RA | 162..400 | 255..17 | 1195 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:40:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 14329507..14329745 | 255..17 | 1195 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 16:40:07 has no hits.
BS14447.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:52:18 Download gff for
BS14447.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-PA | 71..309 | 17..255 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:18:45 Download gff for
BS14447.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 162..400 | 17..255 | 100 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:03:52 Download gff for
BS14447.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 162..400 | 17..255 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:03:52 Download gff for
BS14447.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14329507..14329745 | 17..255 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:18:45 Download gff for
BS14447.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 14322607..14322845 | 17..255 | 100 | | Minus |
BS14447.5prime Sequence
339 bp (339 high quality bases) assembled on 2006-10-13
> BS14447.5prime
GAAGTTATCAGTCGACATGTCGCCGCCACATCACGAAAATCGCCTGTTTG
GAATCCACCTTGGCCTGAATTTGGGTGGAGGTGGACATCATCACCACCAC
CATCATCCACCGCCTCCGGTGCACCACTATCACCCACCGCCTCCGGTGCA
CCACCATCACCACCACGGACCTCCAATGCACCACCACGGACCCCCGCCGC
ACCACCACCACCACTACGGACCTCCGCCACCGCCGCCCCACTACGATCAT
CATCATCATCACCACGGCAGCCACTTTGACCATCATCATGGTCCTCACCA
TGGACATCATCATCATCACTGCTAGAAGCTTTCTAGACC
BS14447.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:47:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13482-PA | 309 | CG13482-RA | 1..309 | 17..325 | 1545 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:00:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13482-RA | 540 | CG13482-RA | 92..400 | 17..325 | 1545 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:00:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 14329437..14329745 | 17..325 | 1545 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-10 16:00:23 has no hits.
BS14447.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:52:19 Download gff for
BS14447.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-PA | 1..309 | 17..325 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 20:09:20 Download gff for
BS14447.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 84..400 | 9..325 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:41:14 Download gff for
BS14447.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 84..400 | 9..325 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:41:14 Download gff for
BS14447.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14329429..14329745 | 9..325 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 20:09:20 Download gff for
BS14447.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 14322529..14322845 | 9..325 | 99 | | Plus |
BS14447.complete Sequence
341 bp assembled on 2006-11-01
GenBank Submission: FJ637667
> BS14447.complete
GAAGTTATCAGTCGACATGTCGCCGCCACATCACGAAAATCGCCTGTTTG
GAATCCACCTTGGCCTGAATTTGGGTGGAGGTGGACATCATCACCACCAC
CATCATCCACCGCCTCCGGTGCACCACTATCACCCACCGCCTCCGGTGCA
CCACCATCACCACCACGGACCTCCAATGCACCACCACGGACCCCCGCCGC
ACCACCACCACCACTACGGACCTCCGCCACCGCCGCCCCACTACGATCAT
CATCATCATCACCACGGCAGCCACTTTGACCATCATCATGGTCCTCACCA
TGGACATCATCATCATCACTGCTAGAAGCTTTCTAGACCAT
BS14447.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:35:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13482-RA | 309 | CG13482-PA | 1..309 | 17..325 | 1545 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:35:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13482-RA | 540 | CG13482-RA | 92..400 | 17..325 | 1545 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:35:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 14329437..14329745 | 17..325 | 1545 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 15:35:51 has no hits.
BS14447.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:18:30 Download gff for
BS14447.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 1..309 | 17..325 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:14:46 Download gff for
BS14447.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 1..309 | 17..325 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:51:23 Download gff for
BS14447.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 92..400 | 17..325 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:18:30 Download gff for
BS14447.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 1..309 | 17..325 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:11:47 Download gff for
BS14447.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 92..400 | 17..325 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:11:47 Download gff for
BS14447.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14329437..14329745 | 17..325 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:51:23 Download gff for
BS14447.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 14322537..14322845 | 17..325 | 100 | | Plus |
BS14447.pep Sequence
Translation from 16 to 324
> BS14447.pep
MSPPHHENRLFGIHLGLNLGGGGHHHHHHHPPPPVHHYHPPPPVHHHHHH
GPPMHHHGPPPHHHHHYGPPPPPPHYDHHHHHHGSHFDHHHGPHHGHHHH
HC*
BS14447.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:55:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13482-PA | 102 | CG13482-PA | 1..102 | 1..102 | 708 | 100 | Plus |
CG43349-PB | 70 | CG43349-PB | 6..64 | 24..84 | 202 | 58.5 | Plus |
CG43349-PA | 70 | CG43349-PA | 6..64 | 24..84 | 202 | 58.5 | Plus |
CG43349-PB | 70 | CG43349-PB | 2..68 | 40..100 | 200 | 56.9 | Plus |
CG43349-PA | 70 | CG43349-PA | 2..68 | 40..100 | 200 | 56.9 | Plus |
CG5225-PA | 594 | CG5225-PA | 323..398 | 20..99 | 191 | 46.5 | Plus |
CG5225-PA | 594 | CG5225-PA | 290..398 | 14..101 | 176 | 38.4 | Plus |
CG43355-PC | 170 | CG43355-PC | 1..106 | 15..85 | 166 | 36.8 | Plus |
CG5225-PA | 594 | CG5225-PA | 343..435 | 3..101 | 156 | 33 | Plus |
CG43349-PB | 70 | CG43349-PB | 7..69 | 24..73 | 150 | 51.5 | Plus |
CG43349-PA | 70 | CG43349-PA | 7..69 | 24..73 | 150 | 51.5 | Plus |
CG5225-PA | 594 | CG5225-PA | 147..211 | 24..85 | 145 | 41.9 | Plus |