Clone BS14447 Report

Search the DGRC for BS14447

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:144
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptCG13482-RA
Protein status:BS14447.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS14447.3prime Sequence

255 bp (254 high quality bases) assembled on 2006-10-13

> BS14447.3prime
ATGGTCTAGAAAGCTTCTAGCAGTGATGATGATGATGTCCATGGTGAGGA
CCATGATGATGGTCAAAGTGGCTGCCGTGGTGATGATGATGATGATCGTA
GTGGGGCGGCGGTGGCGGAGGTCCGTAGTGGTGGTGGTGGTGCGGCGGGG
GTCCGTGGTGGTGCATTGGAGGTCCGTGGTGGTGATGGTGGTGCACCGGA
GGCGGTGGGTGATAGTGGTGCACCGGAGGCGGTGGATGATGGTGGTGGTG
ATGAT

BS14447.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:47:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13482-PA 309 CG13482-RA 71..309 255..17 1195 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13482-RA 540 CG13482-RA 162..400 255..17 1195 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:40:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14329507..14329745 255..17 1195 100 Minus
Blast to na_te.dros performed on 2015-02-10 16:40:07 has no hits.

BS14447.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:52:18 Download gff for BS14447.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13482-PA 71..309 17..255 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:18:45 Download gff for BS14447.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 162..400 17..255 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:03:52 Download gff for BS14447.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 162..400 17..255 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:03:52 Download gff for BS14447.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 14329507..14329745 17..255 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:18:45 Download gff for BS14447.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14322607..14322845 17..255 100   Minus

BS14447.5prime Sequence

339 bp (339 high quality bases) assembled on 2006-10-13

> BS14447.5prime
GAAGTTATCAGTCGACATGTCGCCGCCACATCACGAAAATCGCCTGTTTG
GAATCCACCTTGGCCTGAATTTGGGTGGAGGTGGACATCATCACCACCAC
CATCATCCACCGCCTCCGGTGCACCACTATCACCCACCGCCTCCGGTGCA
CCACCATCACCACCACGGACCTCCAATGCACCACCACGGACCCCCGCCGC
ACCACCACCACCACTACGGACCTCCGCCACCGCCGCCCCACTACGATCAT
CATCATCATCACCACGGCAGCCACTTTGACCATCATCATGGTCCTCACCA
TGGACATCATCATCATCACTGCTAGAAGCTTTCTAGACC

BS14447.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13482-PA 309 CG13482-RA 1..309 17..325 1545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:00:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13482-RA 540 CG13482-RA 92..400 17..325 1545 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:00:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14329437..14329745 17..325 1545 100 Plus
Blast to na_te.dros performed on 2015-02-10 16:00:23 has no hits.

BS14447.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:52:19 Download gff for BS14447.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13482-PA 1..309 17..325 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 20:09:20 Download gff for BS14447.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 84..400 9..325 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:41:14 Download gff for BS14447.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 84..400 9..325 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:41:14 Download gff for BS14447.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 14329429..14329745 9..325 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 20:09:20 Download gff for BS14447.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14322529..14322845 9..325 99   Plus

BS14447.complete Sequence

341 bp assembled on 2006-11-01

GenBank Submission: FJ637667

> BS14447.complete
GAAGTTATCAGTCGACATGTCGCCGCCACATCACGAAAATCGCCTGTTTG
GAATCCACCTTGGCCTGAATTTGGGTGGAGGTGGACATCATCACCACCAC
CATCATCCACCGCCTCCGGTGCACCACTATCACCCACCGCCTCCGGTGCA
CCACCATCACCACCACGGACCTCCAATGCACCACCACGGACCCCCGCCGC
ACCACCACCACCACTACGGACCTCCGCCACCGCCGCCCCACTACGATCAT
CATCATCATCACCACGGCAGCCACTTTGACCATCATCATGGTCCTCACCA
TGGACATCATCATCATCACTGCTAGAAGCTTTCTAGACCAT

BS14447.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG13482-RA 309 CG13482-PA 1..309 17..325 1545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:35:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13482-RA 540 CG13482-RA 92..400 17..325 1545 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14329437..14329745 17..325 1545 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:35:51 has no hits.

BS14447.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:18:30 Download gff for BS14447.complete
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 1..309 17..325 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:14:46 Download gff for BS14447.complete
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 1..309 17..325 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:51:23 Download gff for BS14447.complete
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 92..400 17..325 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:18:30 Download gff for BS14447.complete
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 1..309 17..325 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:11:47 Download gff for BS14447.complete
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 92..400 17..325 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:11:47 Download gff for BS14447.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14329437..14329745 17..325 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:51:23 Download gff for BS14447.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14322537..14322845 17..325 100   Plus

BS14447.pep Sequence

Translation from 16 to 324

> BS14447.pep
MSPPHHENRLFGIHLGLNLGGGGHHHHHHHPPPPVHHYHPPPPVHHHHHH
GPPMHHHGPPPHHHHHYGPPPPPPHYDHHHHHHGSHFDHHHGPHHGHHHH
HC*

BS14447.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13482-PA 102 CG13482-PA 1..102 1..102 708 100 Plus
CG43349-PB 70 CG43349-PB 6..64 24..84 202 58.5 Plus
CG43349-PA 70 CG43349-PA 6..64 24..84 202 58.5 Plus
CG43349-PB 70 CG43349-PB 2..68 40..100 200 56.9 Plus
CG43349-PA 70 CG43349-PA 2..68 40..100 200 56.9 Plus
CG5225-PA 594 CG5225-PA 323..398 20..99 191 46.5 Plus
CG5225-PA 594 CG5225-PA 290..398 14..101 176 38.4 Plus
CG43355-PC 170 CG43355-PC 1..106 15..85 166 36.8 Plus
CG5225-PA 594 CG5225-PA 343..435 3..101 156 33 Plus
CG43349-PB 70 CG43349-PB 7..69 24..73 150 51.5 Plus
CG43349-PA 70 CG43349-PA 7..69 24..73 150 51.5 Plus
CG5225-PA 594 CG5225-PA 147..211 24..85 145 41.9 Plus