Clone Sequence Records
BS14467.3prime Sequence
243 bp (243 high quality bases) assembled on 2006-10-13
> BS14467.3prime
ATGGTCTAGAAAGCTTTTAATTAAGGAGAAGTTTAGGCAAAATAACTACG
ATCGTGGCCCGAAAGAGCCACAGGCATTTTGCATTAGCAATTTGCAATTT
GCAAAACAATTTCCAAACAGAAAAAGGAGACAGCTCCTCCTCGCACCACA
AACGTGCACCGTACTGTGTGCACGGGGATGCAGCAAACAGGAAATGGAAT
ACCGTGCCAAAGGCTAAGGGAAGATGCATGTCGACTGATAACT
BS14467.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:48:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31526-PA | 213 | CG31526-RA | 1..213 | 229..17 | 1065 | 100 | Minus |
CG31526-PB | 213 | CG31526-RB | 1..213 | 229..17 | 1065 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:44:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31526-RC | 620 | CG31526-RC | 230..446 | 233..17 | 1070 | 99.5 | Minus |
CG31526-RA | 632 | CG31526-RA | 242..458 | 233..17 | 1070 | 99.5 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:44:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 4533550..4533766 | 233..17 | 1070 | 99.5 | Minus |
Blast to na_te.dros performed on 2015-02-12 17:44:20 has no hits.
BS14467.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:52:35 Download gff for
BS14467.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-PB | 1..213 | 17..229 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:41:22 Download gff for
BS14467.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RA | 240..462 | 12..238 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 20:01:09 Download gff for
BS14467.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RA | 240..462 | 12..238 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 20:01:09 Download gff for
BS14467.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 4533548..4533768 | 16..238 | 97 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:41:22 Download gff for
BS14467.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 359270..359490 | 16..238 | 97 | <- | Minus |
BS14467.5prime Sequence
243 bp (243 high quality bases) assembled on 2006-10-13
> BS14467.5prime
GAAGTTATCAGTCGACATGCATCTTCCCTTAGCCTTTGGCACGGTATTCC
ATTTCCTGTTTGCTGCATCCCCGTGCACACAGTACGGTGCACGTTTGTGG
TGCGAGGAGGAGCTGTCTCCTTTTTCTGTTTGGAAATTGTTTTGCAAATT
GCAAATTGCTAATGCAAAATGCCTGTGGCTCTTTCGGGCCACGATCGTAG
TTATTTTGCCTAAACTTCTCCTTAATTAAAAGCTTTCTAGACC
BS14467.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:48:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31526-PA | 213 | CG31526-RA | 1..213 | 17..229 | 1065 | 100 | Plus |
CG31526-PB | 213 | CG31526-RB | 1..213 | 17..229 | 1065 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:08:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31526-RC | 620 | CG31526-RC | 230..446 | 13..229 | 1070 | 99.5 | Plus |
CG31526-RA | 632 | CG31526-RA | 242..458 | 13..229 | 1070 | 99.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:08:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 4533550..4533766 | 13..229 | 1070 | 99.5 | Plus |
Blast to na_te.dros performed on 2015-02-11 09:08:46 has no hits.
BS14467.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:52:35 Download gff for
BS14467.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-PB | 1..213 | 17..229 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 17:01:24 Download gff for
BS14467.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RA | 240..462 | 8..234 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:57:28 Download gff for
BS14467.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RA | 240..462 | 8..234 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 10:57:28 Download gff for
BS14467.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 4533548..4533770 | 8..234 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 17:01:24 Download gff for
BS14467.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 359270..359492 | 8..234 | 97 | | Plus |
BS14467.complete Sequence
245 bp assembled on 2006-11-01
GenBank Submission: FJ637676
> BS14467.complete
GAAGTTATCAGTCGACATGCATCTTCCCTTAGCCTTTGGCACGGTATTCC
ATTTCCTGTTTGCTGCATCCCCGTGCACACAGTACGGTGCACGTTTGTGG
TGCGAGGAGGAGCTGTCTCCTTTTTCTGTTTGGAAATTGTTTTGCAAATT
GCAAATTGCTAATGCAAAATGCCTGTGGCTCTTTCGGGCCACGATCGTAG
TTATTTTGCCTAAACTTCTCCTTAATTAAAAGCTTTCTAGACCAT
BS14467.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:37:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31526-RC | 213 | CG31526-PC | 1..213 | 17..229 | 1065 | 100 | Plus |
CG31526-RA | 213 | CG31526-PA | 1..213 | 17..229 | 1065 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:37:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31526-RC | 620 | CG31526-RC | 230..446 | 13..229 | 1070 | 99.5 | Plus |
CG31526-RA | 632 | CG31526-RA | 242..458 | 13..229 | 1070 | 99.5 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:37:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 4533550..4533766 | 13..229 | 1070 | 99.5 | Plus |
Blast to na_te.dros performed on 2014-11-27 13:37:53 has no hits.
BS14467.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:53:55 Download gff for
BS14467.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RB | 1..213 | 17..229 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:12:41 Download gff for
BS14467.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RA | 260..482 | 8..234 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:09:01 Download gff for
BS14467.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RA | 246..456 | 17..227 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:53:55 Download gff for
BS14467.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RA | 260..482 | 8..234 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:22:54 Download gff for
BS14467.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31526-RA | 246..456 | 17..227 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:22:54 Download gff for
BS14467.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 4533554..4533764 | 17..227 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:09:01 Download gff for
BS14467.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 359276..359486 | 17..227 | 100 | | Plus |
BS14467.pep Sequence
Translation from 16 to 228
> BS14467.pep
MHLPLAFGTVFHFLFAASPCTQYGARLWCEEELSPFSVWKLFCKLQIANA
KCLWLFRATIVVILPKLLLN*
BS14467.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:39:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31526-PC | 70 | CG31526-PC | 1..70 | 1..70 | 381 | 100 | Plus |
CG31526-PA | 70 | CG31526-PA | 1..70 | 1..70 | 381 | 100 | Plus |