Clone BS14538 Report

Search the DGRC for BS14538

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:145
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptAcyp2-RA
Protein status:BS14538.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS14538.5prime Sequence

339 bp (339 high quality bases) assembled on 2006-10-13

> BS14538.5prime
GAAGTTATCAGTCGACATGGCGGGATCTGGAGTTGCCAAGCAGATATTTG
CCCTCGATTTCGAGATCTTTGGACGAGTGCAAGGTGTGTTCTTCCGCAAA
CACACGTCGCATGAGGCTAAAAGATTGGGAGTTAGGGGCTGGTGCATGAA
TACCCGGGATGGGACCGTCAAGGGACAACTGGAGGCTCCTATGATGAATT
TAATGGAAATGAAACATTGGCTGGAGAACAACCGAATTCCCAACGCTAAG
GTCTCAAAGGCTGAATTTTCGCAAATCCAGGAAATCGAGGACTATACGTT
CACTTCCTTTGACATAAAACATTAAAAGCTTTCTAGACC

BS14538.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG18505-PA 309 Acyp2-RA 1..309 17..325 1545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
Acyp2-RB 619 CG18505-RB 148..458 17..327 1555 100 Plus
Acyp2-RA 543 CG18505-RA 148..458 17..327 1555 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15793210..15793326 211..327 585 100 Plus
3R 32079331 3R 15793042..15793152 101..211 555 100 Plus
3R 32079331 3R 15792835..15792903 17..85 345 100 Plus
Blast to na_te.dros performed on 2015-02-10 16:48:43 has no hits.

BS14538.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:53:21 Download gff for BS14538.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18505-PA 1..309 17..325 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:20:08 Download gff for BS14538.5prime
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 144..458 9..327 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:05:00 Download gff for BS14538.5prime
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 144..458 9..327 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:05:00 Download gff for BS14538.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 15792831..15792901 9..83 94 -> Plus
3R 15792957..15792973 84..100 100 -> Plus
3R 15793042..15793151 101..210 100 -> Plus
3R 15793210..15793326 211..327 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:20:08 Download gff for BS14538.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11618553..11618623 9..83 94 -> Plus
arm_3R 11618679..11618695 84..100 100 -> Plus
arm_3R 11618764..11618873 101..210 100 -> Plus
arm_3R 11618932..11619048 211..327 100   Plus

BS14538.3prime Sequence

339 bp (339 high quality bases) assembled on 2006-10-13

> BS14538.3prime
ATGGTCTAGAAAGCTTTTAATGTTTTATGTCAAAGGAAGTGAACGTATAG
TCCTCGATTTCCTGGATTTGCGAAAATTCAGCCTTTGAGACCTTAGCGTT
GGGAATTCGGTTGTTCTCCAGCCAATGTTTCATTTCCATTAAATTCATCA
TAGGAGCCTCCAGTTGTCCCTTGACGGTCCCATCCCGGGTATTCATGCAC
CAGCCCCTAACTCCCAATCTTTTAGCCTCATGCGACGTGTGTTTGCGGAA
GAACACACCTTGCACTCGTCCAAAGATCTCGAAATCGAGGGCAAATATCT
GCTTGGCAACTCCAGATCCCGCCATGTCGACTGATAACT

BS14538.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:49:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG18505-PA 309 Acyp2-RA 1..309 325..17 1545 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 18:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
Acyp2-RB 619 CG18505-RB 148..458 325..15 1555 100 Minus
Acyp2-RA 543 CG18505-RA 148..458 325..15 1555 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 18:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15793210..15793326 131..15 585 100 Minus
3R 32079331 3R 15793042..15793152 241..131 555 100 Minus
3R 32079331 3R 15792835..15792903 325..257 345 100 Minus
Blast to na_te.dros performed on 2015-02-02 18:02:02 has no hits.

BS14538.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:53:20 Download gff for BS14538.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18505-PA 1..309 17..325 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 15:41:05 Download gff for BS14538.3prime
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 144..458 15..333 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 19:13:09 Download gff for BS14538.3prime
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 144..458 15..333 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 19:13:09 Download gff for BS14538.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 15793042..15793151 132..241 100 -> Minus
3R 15793210..15793326 15..131 100   Minus
3R 15792831..15792901 259..333 94 -> Minus
3R 15792957..15792973 242..258 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 15:41:05 Download gff for BS14538.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11618679..11618695 242..258 100 -> Minus
arm_3R 11618764..11618873 132..241 100 -> Minus
arm_3R 11618932..11619048 15..131 100   Minus
arm_3R 11618553..11618623 259..333 94 -> Minus

BS14538.complete Sequence

341 bp assembled on 2006-11-01

GenBank Submission: FJ637694

> BS14538.complete
GAAGTTATCAGTCGACATGGCGGGATCTGGAGTTGCCAAGCAGATATTTG
CCCTCGATTTCGAGATCTTTGGACGAGTGCAAGGTGTGTTCTTCCGCAAA
CACACGTCGCATGAGGCTAAAAGATTGGGAGTTAGGGGCTGGTGCATGAA
TACCCGGGATGGGACCGTCAAGGGACAACTGGAGGCTCCTATGATGAATT
TAATGGAAATGAAACATTGGCTGGAGAACAACCGAATTCCCAACGCTAAG
GTCTCAAAGGCTGAATTTTCGCAAATCCAGGAAATCGAGGACTATACGTT
CACTTCCTTTGACATAAAACATTAAAAGCTTTCTAGACCAT

BS14538.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:23:38
Subject Length Description Subject Range Query Range Score Percent Strand
Acyp2-RB 309 CG18505-PB 1..309 17..325 1545 100 Plus
Acyp2-RA 309 CG18505-PA 1..309 17..325 1545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:23:39
Subject Length Description Subject Range Query Range Score Percent Strand
Acyp2-RB 619 CG18505-RB 148..458 17..327 1555 100 Plus
Acyp2-RA 543 CG18505-RA 148..458 17..327 1555 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:23:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15793210..15793326 211..327 585 100 Plus
3R 32079331 3R 15793042..15793152 101..211 555 100 Plus
3R 32079331 3R 15792835..15792903 17..85 345 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:23:36 has no hits.

BS14538.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:45:41 Download gff for BS14538.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 1..309 17..325 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:33:09 Download gff for BS14538.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 93..407 9..327 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:23:45 Download gff for BS14538.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 148..454 17..323 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:45:41 Download gff for BS14538.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 93..407 9..327 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:31:02 Download gff for BS14538.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 148..454 17..323 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:31:02 Download gff for BS14538.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15793210..15793322 211..323 100   Plus
3R 15792835..15792901 17..83 100 -> Plus
3R 15792957..15792973 84..100 100 -> Plus
3R 15793042..15793151 101..210 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:23:45 Download gff for BS14538.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11618932..11619044 211..323 100   Plus
arm_3R 11618557..11618623 17..83 100 -> Plus
arm_3R 11618679..11618695 84..100 100 -> Plus
arm_3R 11618764..11618873 101..210 100 -> Plus

BS14538.pep Sequence

Translation from 16 to 324

> BS14538.pep
MAGSGVAKQIFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGT
VKGQLEAPMMNLMEMKHWLENNRIPNAKVSKAEFSQIQEIEDYTFTSFDI
KH*

BS14538.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Acyp2-PB 102 CG18505-PB 1..102 1..102 540 100 Plus
Acyp2-PA 102 CG18505-PA 1..102 1..102 540 100 Plus
CG34161-PC 125 CG34161-PC 32..124 9..101 245 47.3 Plus
CG34161-PA 125 CG34161-PA 32..124 9..101 245 47.3 Plus
CG11052-PD 149 CG11052-PD 56..146 10..100 233 44 Plus