Clone BS14546 Report

Search the DGRC for BS14546

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:145
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptCG13215-RA
Protein status:BS14546.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS14546.3prime Sequence

381 bp (381 high quality bases) assembled on 2006-10-13

> BS14546.3prime
ATGGTCTAGAAAGCTTTTATTTGCCAAAGCTGTCGGTGTAGGCGGCGCGT
CTGGCATCAGCACGAGCCTGGCGAACGACCAATGGATCGTCGGCCAAATA
GTGGGGCGCATAGTCTTCCGAGTCGTAGGATCTGCGATTGGTTGCACCGT
ATCCATGTTTGCCGTACACTGCGCTCTTGGGATAGCAGATGAAATAGTCG
CCCTGGTAGTAATCCGCACTGGATCGCTTCTGGCGCACTGGCTCTCCGGT
AATATCCGTGGCCGAAACGAATCCTGGATTCTGGGCATCCTTAGCGATGG
GTGCTGCTTGGATCAGGCTTAAACCGAAGATCATGGAGATCACAACGATG
GATATGATGCACTTCATGTCGACTGATAACT

BS14546.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13215-PA 351 CG13215-RA 1..351 367..17 1755 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 18:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13215-RA 621 CG13215-RA 95..448 369..16 1770 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 18:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11239667..11240020 16..369 1770 100 Plus
Blast to na_te.dros performed on 2015-02-02 18:05:48 has no hits.

BS14546.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:53:34 Download gff for BS14546.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13215-PA 1..351 17..367 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 15:41:17 Download gff for BS14546.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 85..448 16..378 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 19:13:32 Download gff for BS14546.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 85..448 16..378 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 19:13:32 Download gff for BS14546.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 11239667..11240030 16..378 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 15:41:17 Download gff for BS14546.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7127172..7127535 16..378 98   Plus

BS14546.5prime Sequence

381 bp (381 high quality bases) assembled on 2006-10-13

> BS14546.5prime
GAAGTTATCAGTCGACATGAAGTGCATCATATCCATCGTTGTGATCTCCA
TGATCTTCGGTTTAAGCCTGATCCAAGCAGCACCCATCGCTAAGGATGCC
CAGAATCCAGGATTCGTTTCGGCCACGGATATTACCGGAGAGCCAGTGCG
CCAGAAGCGATCCAGTGCGGATTACTACCAGGGCGACTATTTCATCTGCT
ATCCCAAGAGCGCAGTGTACGGCAAACATGGATACGGTGCAACCAATCGC
AGATCCTACGACTCGGAAGACTATGCGCCCCACTATTTGGCCGACGATCC
ATTGGTCGTTCGCCAGGCTCGTGCTGATGCCAGACGCGCCGCCTACACCG
ACAGCTTTGGCAAATAAAAGCTTTCTAGACC

BS14546.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13215-PA 351 CG13215-RA 1..351 17..367 1755 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13215-RA 621 CG13215-RA 95..448 15..368 1770 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11239667..11240020 368..15 1770 100 Minus
Blast to na_te.dros performed on 2015-02-12 11:09:12 has no hits.

BS14546.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:53:35 Download gff for BS14546.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13215-PA 1..351 17..367 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:44:58 Download gff for BS14546.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 85..448 6..368 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:26:58 Download gff for BS14546.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 85..448 6..368 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:26:58 Download gff for BS14546.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 11239667..11240030 6..368 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:44:58 Download gff for BS14546.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7127172..7127535 6..368 98   Minus

BS14546.complete Sequence

383 bp assembled on 2006-11-01

GenBank Submission: FJ637698

> BS14546.complete
GAAGTTATCAGTCGACATGAAGTGCATCATATCCATCGTTGTGATCTCCA
TGATCTTCGGTTTAAGCCTGATCCAAGCAGCACCCATCGCTAAGGATGCC
CAGAATCCAGGATTCGTTTCGGCCACGGATATTACCGGAGAGCCAGTGCG
CCAGAAGCGATCCAGTGCGGATTACTACCAGGGCGACTATTTCATCTGCT
ATCCCAAGAGCGCAGTGTACGGCAAACATGGATACGGTGCAACCAATCGC
AGATCCTACGACTCGGAAGACTATGCGCCCCACTATTTGGCCGACGATCC
ATTGGTCGTTCGCCAGGCTCGTGCTGATGCCAGACGCGCCGCCTACACCG
ACAGCTTTGGCAAATAAAAGCTTTCTAGACCAT

BS14546.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13215-RA 351 CG13215-PA 1..351 17..367 1755 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13215-RA 621 CG13215-RA 95..448 15..368 1770 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:34:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11239667..11240020 368..15 1770 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:34:53 has no hits.

BS14546.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:36:24 Download gff for BS14546.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 1..351 17..367 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:09:31 Download gff for BS14546.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 1..351 17..367 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:05:00 Download gff for BS14546.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 97..445 17..365 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:36:24 Download gff for BS14546.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 1..351 17..367 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:21:41 Download gff for BS14546.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 97..445 17..365 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:21:41 Download gff for BS14546.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11239670..11240018 17..365 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:05:00 Download gff for BS14546.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7127175..7127523 17..365 100   Minus

BS14546.pep Sequence

Translation from 16 to 366

> BS14546.pep
MKCIISIVVISMIFGLSLIQAAPIAKDAQNPGFVSATDITGEPVRQKRSS
ADYYQGDYFICYPKSAVYGKHGYGATNRRSYDSEDYAPHYLADDPLVVRQ
ARADARRAAYTDSFGK*

BS14546.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG13215-PA 116 CG13215-PA 1..116 1..116 605 100 Plus