Clone BS14554 Report

Search the DGRC for BS14554

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:145
Well:54
Vector:pDNR-Dual
Associated Gene/TranscriptCG31230-RA
Protein status:BS14554.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS14554.5prime Sequence

210 bp (210 high quality bases) assembled on 2006-10-13

> BS14554.5prime
GAAGTTATCAGTCGACATGAAAGCAGCAATAGTACGGATACCAATCGGAA
TTTACTTCAAAACCCTAATGAAGATGAACAGAAATCGTGGGGATCGTTGG
AGAAAGATGGCCGAGCTCGTATTCTCCTTATGTGTGATTGACAAAGCCGA
GGATGTAGTTCTTGATGTTATTATGTTAAAGTTCCTCGGAGAGTAGAAGC
TTTCTAGACC

BS14554.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG31230-PA 180 CG31230-RA 1..180 17..196 900 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 18:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG31230-RA 416 CG31230-RA 56..237 15..196 910 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 18:06:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18671734..18671915 15..196 910 100 Plus
Blast to na_te.dros performed on 2015-02-02 18:06:15 has no hits.

BS14554.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:53:41 Download gff for BS14554.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31230-PA 1..180 17..196 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 15:41:19 Download gff for BS14554.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 43..241 2..200 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 19:13:34 Download gff for BS14554.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 43..241 2..200 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 19:13:34 Download gff for BS14554.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 18671721..18671919 2..200 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 15:41:19 Download gff for BS14554.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14497443..14497641 2..200 96   Plus

BS14554.complete Sequence

212 bp assembled on 2006-11-01

GenBank Submission: FJ637701

> BS14554.complete
GAAGTTATCAGTCGACATGAAAGCAGCAATAGTACGGATACCAATCGGAA
TTTACTTCAAAACCCTAATGAAGATGAACAGAAATCGTGGGGATCGTTGG
AGAAAGATGGCCGAGCTCGTATTCTCCTTATGTGTGATTGACAAAGCCGA
GGATGTAGTTCTTGATGTTATTATGTTAAAGTTCCTCGGAGAGTAGAAGC
TTTCTAGACCAT

BS14554.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG31230-RA 180 CG31230-PA 1..180 17..196 900 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG31230-RA 416 CG31230-RA 56..237 15..196 910 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:41:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18671734..18671915 15..196 910 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:41:07 has no hits.

BS14554.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:36:28 Download gff for BS14554.complete
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 1..180 17..196 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:54:25 Download gff for BS14554.complete
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 43..241 2..200 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:29:31 Download gff for BS14554.complete
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 58..237 17..196 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:36:28 Download gff for BS14554.complete
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 43..241 2..200 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:36:15 Download gff for BS14554.complete
Subject Subject Range Query Range Percent Splice Strand
CG31230-RA 58..237 17..196 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:36:15 Download gff for BS14554.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18671736..18671915 17..196 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:29:31 Download gff for BS14554.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14497458..14497637 17..196 100   Plus

BS14554.pep Sequence

Translation from 16 to 195

> BS14554.pep
MKAAIVRIPIGIYFKTLMKMNRNRGDRWRKMAELVFSLCVIDKAEDVVLD
VIMLKFLGE*

BS14554.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:08:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG31230-PA 59 CG31230-PA 1..59 1..59 298 100 Plus