Clone BS14776 Report

Search the DGRC for BS14776

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:147
Well:76
Vector:pDNR-Dual
Associated Gene/Transcriptl(1)G0136-RA
Protein status:BS14776.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS14776.3prime Sequence

423 bp (423 high quality bases) assembled on 2006-10-13

> BS14776.3prime
ATGGTCTAGAAAGCTTTTACATGCTGAACGATTCGCCGCAGCCGCATGTG
CCCTTAATGTTCGGATTGTTAAACACGAACTCGCTGGACAGCTTCGATTC
CACAAAGTCCATCTCGGTACCCAGCAGCGACAACTGCGCTTTCTTGTCGA
TGAAGACCTTGACGCCATCCTGGACCACCTCCTCATCCAACTTGTCTTTT
TGGCTGGCATAGTCCAGCGTGTAGGACAGACCATTGCATCCTCGCTGCCG
TACGCCCACCTTTAGGCCAACCATGTCCGGCTTGTCCTGCAGAAGCGTCT
TGATGCGTAGCACCGCCGCGGGTGTCAGAGTCAGAGCGGCCCGCGTCGGG
ATTAACTTCCGGCCTTTCACCGCCCGCACTGTCGCCGTTGCCACCACACG
TGTCGCCATGTCGACTGATAACT

BS14776.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:52:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG8198-PA 393 l(1)G0136-RA 1..393 409..17 1965 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:20:37
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0136-RA 780 CG8198-RA 100..493 409..16 1970 100 Minus
l(1)G0136-RB 783 CG8198-RB 100..496 409..16 1930 99.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:20:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15735388..15735493 121..16 530 100 Minus
X 23542271 X 15734369..15734452 409..326 420 100 Minus
X 23542271 X 15735245..15735324 197..118 400 100 Minus
X 23542271 X 15735098..15735174 272..196 385 100 Minus
X 23542271 X 15734552..15734608 326..270 285 100 Minus
Blast to na_te.dros performed on 2015-02-12 11:20:34 has no hits.

BS14776.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:56:19 Download gff for BS14776.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8198-PA 1..393 17..409 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:47:48 Download gff for BS14776.3prime
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 98..493 16..413 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:39:52 Download gff for BS14776.3prime
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 98..493 16..413 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:39:52 Download gff for BS14776.3prime
Subject Subject Range Query Range Percent Splice Strand
X 15735247..15735321 121..195 100 -> Minus
X 15735389..15735493 16..120 100   Minus
X 15734367..15734452 326..413 97 -> Minus
X 15734553..15734606 272..325 100 -> Minus
X 15735099..15735174 196..271 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:47:48 Download gff for BS14776.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 15628400..15628485 326..413 97 -> Minus
arm_X 15628586..15628639 272..325 100 -> Minus
arm_X 15629132..15629207 196..271 100 -> Minus
arm_X 15629280..15629354 121..195 100 -> Minus
arm_X 15629422..15629526 16..120 100   Minus

BS14776.5prime Sequence

423 bp (423 high quality bases) assembled on 2006-10-13

> BS14776.5prime
GAAGTTATCAGTCGACATGGCGACACGTGTGGTGGCAACGGCGACAGTGC
GGGCGGTGAAAGGCCGGAAGTTAATCCCGACGCGGGCCGCTCTGACTCTG
ACACCCGCGGCGGTGCTACGCATCAAGACGCTTCTGCAGGACAAGCCGGA
CATGGTTGGCCTAAAGGTGGGCGTACGGCAGCGAGGATGCAATGGTCTGT
CCTACACGCTGGACTATGCCAGCCAAAAAGACAAGTTGGATGAGGAGGTG
GTCCAGGATGGCGTCAAGGTCTTCATCGACAAGAAAGCGCAGTTGTCGCT
GCTGGGTACCGAGATGGACTTTGTGGAATCGAAGCTGTCCAGCGAGTTCG
TGTTTAACAATCCGAACATTAAGGGCACATGCGGCTGCGGCGAATCGTTC
AGCATGTAAAAGCTTTCTAGACC

BS14776.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG8198-PA 393 l(1)G0136-RA 1..393 17..409 1965 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:13:01
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0136-RA 780 CG8198-RA 100..493 17..410 1970 100 Plus
l(1)G0136-RB 783 CG8198-RB 100..496 17..410 1930 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 12:12:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15735388..15735493 305..410 530 100 Plus
X 23542271 X 15734369..15734452 17..100 420 100 Plus
X 23542271 X 15735245..15735324 229..308 400 100 Plus
X 23542271 X 15735098..15735174 154..230 385 100 Plus
X 23542271 X 15734552..15734608 100..156 285 100 Plus
Blast to na_te.dros performed on 2015-02-08 12:12:57 has no hits.

BS14776.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:56:20 Download gff for BS14776.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8198-PA 1..393 17..409 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:40:50 Download gff for BS14776.5prime
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 98..493 13..410 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:45:28 Download gff for BS14776.5prime
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 98..493 13..410 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:45:28 Download gff for BS14776.5prime
Subject Subject Range Query Range Percent Splice Strand
X 15734367..15734452 13..100 97 -> Plus
X 15734553..15734606 101..154 100 -> Plus
X 15735099..15735174 155..230 100 -> Plus
X 15735247..15735321 231..305 100 -> Plus
X 15735389..15735493 306..410 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:40:50 Download gff for BS14776.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 15629280..15629354 231..305 100 -> Plus
arm_X 15629422..15629526 306..410 100   Plus
arm_X 15629132..15629207 155..230 100 -> Plus
arm_X 15628400..15628485 13..100 97 -> Plus
arm_X 15628586..15628639 101..154 100 -> Plus

BS14776.complete Sequence

425 bp assembled on 2006-11-01

GenBank Submission: FJ637783

> BS14776.complete
GAAGTTATCAGTCGACATGGCGACACGTGTGGTGGCAACGGCGACAGTGC
GGGCGGTGAAAGGCCGGAAGTTAATCCCGACGCGGGCCGCTCTGACTCTG
ACACCCGCGGCGGTGCTACGCATCAAGACGCTTCTGCAGGACAAGCCGGA
CATGGTTGGCCTAAAGGTGGGCGTACGGCAGCGAGGATGCAATGGTCTGT
CCTACACGCTGGACTATGCCAGCCAAAAAGACAAGTTGGATGAGGAGGTG
GTCCAGGATGGCGTCAAGGTCTTCATCGACAAGAAAGCGCAGTTGTCGCT
GCTGGGTACCGAGATGGACTTTGTGGAATCGAAGCTGTCCAGCGAGTTCG
TGTTTAACAATCCGAACATTAAGGGCACATGCGGCTGCGGCGAATCGTTC
AGCATGTAAAAGCTTTCTAGACCAT

BS14776.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0136-RA 393 CG8198-PA 1..393 17..409 1965 100 Plus
l(1)G0136-RB 396 CG8198-PB 1..396 17..409 1900 99.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:51:06
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0136-RA 780 CG8198-RA 100..493 17..410 1970 100 Plus
l(1)G0136-RB 783 CG8198-RB 100..496 17..410 1905 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15735388..15735493 305..410 530 100 Plus
X 23542271 X 15734369..15734452 17..100 420 100 Plus
X 23542271 X 15735245..15735324 229..308 400 100 Plus
X 23542271 X 15735098..15735174 154..230 385 100 Plus
X 23542271 X 15734552..15734608 100..156 285 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:51:04 has no hits.

BS14776.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:35:18 Download gff for BS14776.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 1..393 17..409 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:08:11 Download gff for BS14776.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 88..483 13..410 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:26:35 Download gff for BS14776.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 100..490 17..407 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:35:19 Download gff for BS14776.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 88..483 13..410 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:57:17 Download gff for BS14776.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 100..490 17..407 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:57:17 Download gff for BS14776.complete
Subject Subject Range Query Range Percent Splice Strand
X 15734369..15734452 17..100 100 -> Plus
X 15734553..15734606 101..154 100 -> Plus
X 15735099..15735174 155..230 100 -> Plus
X 15735247..15735321 231..305 100 -> Plus
X 15735389..15735490 306..407 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:26:35 Download gff for BS14776.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15628402..15628485 17..100 100 -> Plus
arm_X 15628586..15628639 101..154 100 -> Plus
arm_X 15629132..15629207 155..230 100 -> Plus
arm_X 15629280..15629354 231..305 100 -> Plus
arm_X 15629422..15629523 306..407 100   Plus

BS14776.pep Sequence

Translation from 16 to 408

> BS14776.pep
MATRVVATATVRAVKGRKLIPTRAALTLTPAAVLRIKTLLQDKPDMVGLK
VGVRQRGCNGLSYTLDYASQKDKLDEEVVQDGVKVFIDKKAQLSLLGTEM
DFVESKLSSEFVFNNPNIKGTCGCGESFSM*

BS14776.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0136-PA 130 CG8198-PA 1..130 1..130 651 100 Plus
l(1)G0136-PB 131 CG8198-PB 1..131 1..130 639 99.2 Plus