Clone BS14938 Report

Search the DGRC for BS14938

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:149
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptCG31846-RA
Protein status:BS14938.pep:
Sequenced Size:16

Clone Sequence Records

BS14938.3prime Sequence

282 bp (282 high quality bases) assembled on 2006-10-13

> BS14938.3prime
ATGGTCTAGAAAGCTTTCAGCCTCGAAGTCGAAGGGCTGGCGCAGTTGAG
TGGCGGGCTGAGGATGGGCTGCGTTGATCGCCAGTGGTCGGCTGCTTTTC
TAGCTCCGTTAAGTCGTTCTTGTTGGTTGGTTGGTTGGTTGTGTTGCTGT
TGTTGCTGTTGCTGTTGCACTGTGTGTTTCGTATAGGCTGTGTTTTTTTC
CAGCGGTGATGCTTCTGACTGCGCCGGCGACTCGTCCTGCGACGCTCCTG
CGGCGAATCCTGGATCATGTCGACTGATAACT

BS14938.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:54:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG31846-PA 252 CG31846-RA 1..252 268..17 1260 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 10:22:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG42784-RI 5345 CG42784-RI 1341..1592 268..17 1260 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 10:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13484360..13484611 268..17 1260 100 Minus
Blast to na_te.dros performed on 2015-01-31 10:22:26 has no hits.

BS14938.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:58:07 Download gff for BS14938.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31846-PA 1..252 17..268 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 23:37:36 Download gff for BS14938.3prime
Subject Subject Range Query Range Percent Splice Strand
CG42784-RI 1341..1595 13..268 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 12:46:31 Download gff for BS14938.3prime
Subject Subject Range Query Range Percent Splice Strand
CG42784-RI 1341..1595 13..268 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 12:46:31 Download gff for BS14938.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 13484360..13484615 12..268 98 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 23:37:36 Download gff for BS14938.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13484360..13484615 12..268 98 -> Minus

BS14938.5prime Sequence

282 bp (282 high quality bases) assembled on 2006-10-13

> BS14938.5prime
GAAGTTATCAGTCGACATGATCCAGGATTCGCCGCAGGAGCGTCGCAGGA
CGAGTCGCCGGCGCAGTCAGAAGCATCACCGCTGGAAAAAAACACAGCCT
ATACGAAACACACAGTGCAACAGCAACAGCAACAACAGCAACACAACCAA
CCAACCAACCAACAAGAACGACTTAACGGAGCTAGAAAAGCAGCCGACCA
CTGGCGATCAACGCAGCCCATCCTCAGCCCGCCACTCAACTGCGCCAGCC
CTTCGACTTCGAGGCTGAAAGCTTTCTAGACC

BS14938.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG31846-PA 252 CG31846-RA 1..252 17..268 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG42784-RI 5345 CG42784-RI 1341..1592 17..268 1260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13484360..13484611 17..268 1260 100 Plus
Blast to na_te.dros performed on 2015-02-11 09:15:39 has no hits.

BS14938.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:58:08 Download gff for BS14938.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31846-PA 1..252 17..268 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 17:04:55 Download gff for BS14938.5prime
Subject Subject Range Query Range Percent Splice Strand
CG42784-RI 1341..1595 17..272 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 11:33:25 Download gff for BS14938.5prime
Subject Subject Range Query Range Percent Splice Strand
CG42784-RI 1341..1595 17..272 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 11:33:25 Download gff for BS14938.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 13484360..13484614 17..272 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 17:04:55 Download gff for BS14938.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13484360..13484614 17..272 99   Plus

BS14938.complete Sequence

284 bp assembled on 2006-11-01

GenBank Submission: FJ638864

> BS14938.complete
GAAGTTATCAGTCGACATGATCCAGGATTCGCCGCAGGAGCGTCGCAGGA
CGAGTCGCCGGCGCAGTCAGAAGCATCACCGCTGGAAAAAAACACAGCCT
ATACGAAACACACAGTGCAACAGCAACAGCAACAACAGCAACACAACCAA
CCAACCAACCAACAAGAACGACTTAACGGAGCTAGAAAAGCAGCCGACCA
CTGGCGATCAACGCAGCCCATCCTCAGCCCGCCACTCAACTGCGCCAGCC
CTTCGACTTCGAGGCTGAAAGCTTTCTAGACCAT

BS14938.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 13:04:17 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG42784-RI 5345 CG42784-RI 1341..1592 17..268 1260 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13484360..13484611 17..268 1260 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:04:16 has no hits.

BS14938.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:46:41 Download gff for BS14938.complete
Subject Subject Range Query Range Percent Splice Strand
CG31846-RA 1..252 17..268 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:34:26 Download gff for BS14938.complete
Subject Subject Range Query Range Percent Splice Strand
CG31846-RA 1334..1588 17..272 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:48:21 Download gff for BS14938.complete
Subject Subject Range Query Range Percent Splice Strand
CG42784-RI 1341..1591 17..267 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:46:41 Download gff for BS14938.complete
Subject Subject Range Query Range Percent Splice Strand
CG31846-RA 1334..1588 17..272 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:10:22 Download gff for BS14938.complete
Subject Subject Range Query Range Percent Splice Strand
CG42784-RI 1341..1591 17..267 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:10:22 Download gff for BS14938.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13484360..13484610 17..267 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:48:21 Download gff for BS14938.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13484360..13484610 17..267 100   Plus

BS14938.pep Sequence

Translation from 16 to 267

> BS14938.pep
MIQDSPQERRRTSRRRSQKHHRWKKTQPIRNTQCNSNSNNSNTTNQPTNK
NDLTELEKQPTTGDQRSPSSARHSTAPALRLRG*
Sequence BS14938.pep has no blast hits.