Clone BS15154 Report

Search the DGRC for BS15154

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:151
Well:54
Vector:pDNR-Dual
Associated Gene/TranscriptCG32284-RA
Protein status:BS15154.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS15154.3prime Sequence

340 bp (340 high quality bases) assembled on 2006-10-24

> BS15154.3prime
ATGGTCTAGAAAGCTTTTACTTGGTTGGTGCCATTGCAGAACATTCATCT
GGAACTTCAGACCGGCACATTTTCAAATTGGGATCAAAGTACTGCTCTCA
CTTTGCAGCTCTTAATCAACGACAAAACTGATCCATTGACCACGTAACAA
TAAACGTAGGTTCTACAAGTTGGATCAGCCTGGTTTTCCATTATGGTGGT
GGTTGTAACTTCGCTGCAGGCTTCTTCCGCACTCCAAGTCTTCGAGTTGT
GGTCGTCAAACTCTGGAGCTGGCAAAGCCGTGAGGCAATGAGCCAGCAAC
AGTAAAAACATTATACGCAGCCACATGTCGACTGATAACT

BS15154.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284-PA 309 CG32284-RA 1..229 326..98 1145 100 Minus
CG32284-PA 309 CG32284-RA 232..305 94..21 370 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284-RA 457 CG32284-RA 7..317 327..16 1505 99 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3186759..3186899 300..160 705 100 Minus
3L 28110227 3L 3186963..3187105 159..16 640 97.9 Minus
Blast to na_te.dros performed on 2015-02-12 05:54:17 has no hits.

BS15154.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:18:31 Download gff for BS15154.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32284-PA 1..309 17..326 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:52:20 Download gff for BS15154.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32284-PA 1..309 17..326 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 06:30:03 Download gff for BS15154.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..317 16..329 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:47:29 Download gff for BS15154.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..317 16..329 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:47:29 Download gff for BS15154.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 3186670..3186697 300..327 100 -> Minus
3L 3186760..3186899 160..299 100 -> Minus
3L 3186963..3187105 16..159 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 06:30:03 Download gff for BS15154.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3186670..3186697 300..327 100 -> Minus
arm_3L 3186760..3186899 160..299 100 -> Minus
arm_3L 3186963..3187105 16..159 97   Minus

BS15154.5prime Sequence

339 bp (339 high quality bases) assembled on 2006-10-23

> BS15154.5prime
GAAGTTATCAGTCGACATGTGGCTGCGTATAATGTTTTTACTGTTGCTGG
CTCATTGCCTCACGGCTTTGCCAGCTCCAGAGTTTGACGACCACAACTCG
AAGACTTGGAGTGCGGAAGAAGCCTGCAGCGAAGTTACAACCACCACCAT
AATGGAAAACCAGGCTGATCCAACTTGTAGAACCTACGTTTATTGTTACG
TGGTCAATGGATCAGTTTTGTCGTTGATTAAGAGCTGCAAAGTGAACCAG
TACTTTGATCCCAATTTGAAAATGTGCCGGTCTGAAGTTCCAGATGAATG
TTCTGCAATGGCACCAACCAACTAAAAGCTTTCTAGACC

BS15154.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284-PA 309 CG32284-RA 1..309 17..325 1545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 12:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284-RA 457 CG32284-RA 7..317 16..326 1555 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 12:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3186963..3187105 184..326 715 100 Plus
3L 28110227 3L 3186759..3186899 43..183 705 100 Plus
Blast to na_te.dros performed on 2015-02-13 12:42:38 has no hits.

BS15154.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:18:32 Download gff for BS15154.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32284-PA 1..309 17..325 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:52:21 Download gff for BS15154.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32284-PA 1..309 17..325 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 18:03:54 Download gff for BS15154.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..317 14..326 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:21:09 Download gff for BS15154.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..317 14..326 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:21:09 Download gff for BS15154.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 3186670..3186697 16..43 100 -> Plus
3L 3186760..3186899 44..183 100 -> Plus
3L 3186963..3187105 184..326 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 18:03:54 Download gff for BS15154.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3186670..3186697 16..43 100 -> Plus
arm_3L 3186760..3186899 44..183 100 -> Plus
arm_3L 3186963..3187105 184..326 100   Plus

BS15154.complete Sequence

341 bp assembled on 2006-11-01

GenBank Submission: FJ637882

> BS15154.complete
GAAGTTATCAGTCGACATGTGGCTGCGTATAATGTTTTTACTGTTGCTGG
CTCATTGCCTCACGGCTTTGCCAGCTCCAGAGTTTGACGACCACAACTCG
AAGACTTGGAGTGCGGAAGAAGCCTGCAGCGAAGTTACAACCACCACCAT
AATGGAAAACCAGGCTGATCCAACTTGTAGAACCTACGTTTATTGTTACG
TGGTCAATGGATCAGTTTTGTCGTTGATTAAGAGCTGCAAAGTGAACCAG
TACTTTGATCCCAATTTGAAAATGTGCCGGTCTGAAGTTCCAGATGAATG
TTCTGCAATGGCACCAACCAACTAAAAGCTTTCTAGACCAT

BS15154.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284-RA 309 CG32284-PA 1..309 17..325 1545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284-RA 457 CG32284-RA 7..317 16..326 1555 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3186963..3187105 184..326 715 100 Plus
3L 28110227 3L 3186759..3186899 43..183 705 100 Plus
Blast to na_te.dros performed on 2014-11-27 23:51:46 has no hits.

BS15154.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:18:29 Download gff for BS15154.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..309 17..325 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:14:44 Download gff for BS15154.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..317 14..326 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:40:05 Download gff for BS15154.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 8..314 17..323 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:18:29 Download gff for BS15154.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..317 14..326 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:09:50 Download gff for BS15154.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 8..314 17..323 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:09:50 Download gff for BS15154.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3186760..3186899 44..183 100 -> Plus
3L 3186963..3187102 184..323 100   Plus
3L 3186671..3186697 17..43 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:40:05 Download gff for BS15154.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3186760..3186899 44..183 100 -> Plus
arm_3L 3186963..3187102 184..323 100   Plus
arm_3L 3186671..3186697 17..43 100 -> Plus

BS15154.pep Sequence

Translation from 16 to 324

> BS15154.pep
MWLRIMFLLLLAHCLTALPAPEFDDHNSKTWSAEEACSEVTTTTIMENQA
DPTCRTYVYCYVVNGSVLSLIKSCKVNQYFDPNLKMCRSEVPDECSAMAP
TN*

BS15154.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284-PA 102 CG32284-PA 1..102 1..102 555 100 Plus
CG14957-PA 96 CG14957-PA 1..95 1..95 254 50.5 Plus
CG42494-PC 283 CG42494-PC 215..283 28..96 232 55.1 Plus
CG42494-PB 283 CG42494-PB 215..283 28..96 232 55.1 Plus
CG42494-PA 283 CG42494-PA 215..283 28..96 232 55.1 Plus
CG42494-PC 283 CG42494-PC 123..188 31..95 163 42.4 Plus
CG42494-PB 283 CG42494-PB 123..188 31..95 163 42.4 Plus