Clone BS15274 Report

Search the DGRC for BS15274

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:152
Well:74
Vector:pDNR-Dual
Associated Gene/Transcriptl(3)87Df-RA
Protein status:BS15274.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS15274.3prime Sequence

363 bp (363 high quality bases) assembled on 2006-10-24

> BS15274.3prime
ATGGTCTAGAAAGCTTCTCCCTCGACTTCAGATCTAAGTCTCTCTCCCTT
TGGGTGCCCTCATAAAGGGCTTGTCGTCTCATCGCCTCACGCAACTGCTG
CTGCTCGAATCTCCTGACGGACCATTGATACCTGCAGGTCATCCAGTAGG
CGATGGTGCCGCAAAAGAAGGAGCCGAAGCCCACGTGGGTGGACAGGTGG
GTTCGCGAGGTGCCCAGAAAAGTCAGCAAGCCGATGCCGATCCCTCCGCT
GATTCCGTAGAGAAAACTGTTACGAAAGCACGGGATCTGCGCCACATCGC
GTCCGAAGATAACGAAGCTCTTGGCGGGTTCCTCGGGTTCTTCGGCCATG
TCGACTGATAACT

BS15274.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG7620-PA 333 l(3)87Df-RA 1..327 349..23 1560 99 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)87Df-RA 551 CG7620-RA 69..396 350..23 1595 99.1 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:40:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13031080..13031272 321..129 935 99 Minus
3R 32079331 3R 13031331..13031443 135..23 550 99.1 Minus
Blast to na_te.dros performed on 2015-02-11 04:40:13 has no hits.

BS15274.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:22:07 Download gff for BS15274.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7620-PA 1..333 17..349 98   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:57:13 Download gff for BS15274.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7620-PA 1..333 17..349 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 06:38:36 Download gff for BS15274.3prime
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 69..396 23..350 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:13:16 Download gff for BS15274.3prime
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 69..396 23..350 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:13:16 Download gff for BS15274.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 13031082..13031269 132..319 98 -> Minus
3R 13031335..13031443 23..131 99   Minus
3R 13030981..13031011 320..350 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 06:38:36 Download gff for BS15274.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8856703..8856733 320..350 100 -> Minus
arm_3R 8856804..8856991 132..319 98 -> Minus
arm_3R 8857057..8857165 23..131 99   Minus

BS15274.complete Sequence

365 bp assembled on 2006-11-01

GenBank Submission: FJ637909

> BS15274.complete
GAAGTTATCAGTCGACATGGCCGAAGAACCCGAGGAACCCGCCAAGAGCT
TCGTTATCTTCGGACGCGATGTGGCGCAGATCCCGTGCTTTCGTAACAGT
TTTCTCTACGGAATCAGCGGAGGGATCGGCATCGGCTTGCTGACTTTTCT
GGGCACCTCGCGAACCCACCTGTCCACCCACGTGGGCTTCGGCTCCTTCT
TCTGCGGCACCATCGCCTACTGGATGACCTGCAGGTATCAATGGTCCGTC
AGGAGATTCGAGCAGCAGCAATTGCGTGAGGCGATGAGACGACAAGCCCT
TTATGAGGGCACCCAAAGGGAGAGAGACTTAGATCTGAAGTCGGCGTAGA
AGCTTTCTAGACCAT

BS15274.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)87Df-RA 333 CG7620-PA 1..333 17..349 1650 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)87Df-RA 551 CG7620-RA 69..402 16..349 1655 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13031080..13031272 45..237 950 99.5 Plus
3R 32079331 3R 13031331..13031449 231..349 595 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:47:18 has no hits.

BS15274.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:20:50 Download gff for BS15274.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 1..333 17..349 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:52:33 Download gff for BS15274.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 40..373 16..349 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:55:03 Download gff for BS15274.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 70..402 17..349 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:20:50 Download gff for BS15274.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 40..373 16..349 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:26:57 Download gff for BS15274.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 70..402 17..349 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:26:57 Download gff for BS15274.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13030982..13031011 17..46 100 -> Plus
3R 13031082..13031269 47..234 99 -> Plus
3R 13031335..13031449 235..349 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:55:03 Download gff for BS15274.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8856704..8856733 17..46 100 -> Plus
arm_3R 8856804..8856991 47..234 99 -> Plus
arm_3R 8857057..8857171 235..349 100   Plus

BS15274.5prime Sequence

363 bp (363 high quality bases) assembled on 2006-10-24

> BS15274.5prime
GAAGTTATCAGTCGACATGGCCGAAGAACCCGAGGAACCCGCCAAGAGCT
TCGTTATCTTCGGACGCGATGTGGCGCAGATCCCGTGCTTTCGTAACAGT
TTTCTCTACGGAATCAGCGGAGGGATCGGCATCGGCTTGCTGACTTTTCT
GGGCACCTCGCGAACCCACCTGTCCACCCACGTGGGCTTCGGCTCCTTCT
TCTGCGGCACCATCGCCTACTGGATGACCTGCAGGTATCAATGGTCCGTC
AGGAGATTCGAGCAGCAGCAATTGCGTGAGGCGATGAGACGACAAGCCCT
TTATGAGGGCACCCAAAGGGAGAGAGACTTAGATCTGAAGTCGGCGTAGA
AGCTTTCTAGACC

BS15274.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG7620-PA 333 l(3)87Df-RA 1..333 17..349 1640 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:12:51
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)87Df-RA 551 CG7620-RA 69..402 16..349 1655 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13031080..13031272 45..237 950 99.5 Plus
3R 32079331 3R 13031331..13031449 231..349 595 100 Plus
Blast to na_te.dros performed on 2015-02-11 23:12:47 has no hits.

BS15274.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:22:08 Download gff for BS15274.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7620-PA 1..333 17..349 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 12:57:14 Download gff for BS15274.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7620-PA 1..333 17..349 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:35:26 Download gff for BS15274.5prime
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 69..402 16..349 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:42:29 Download gff for BS15274.5prime
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 69..402 16..349 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:42:29 Download gff for BS15274.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 13030981..13031011 16..46 100 -> Plus
3R 13031082..13031269 47..234 99 -> Plus
3R 13031335..13031449 235..349 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:35:26 Download gff for BS15274.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8856703..8856733 16..46 100 -> Plus
arm_3R 8856804..8856991 47..234 99 -> Plus
arm_3R 8857057..8857171 235..349 100   Plus

BS15274.pep Sequence

Translation from 16 to 348

> BS15274.pep
MAEEPEEPAKSFVIFGRDVAQIPCFRNSFLYGISGGIGIGLLTFLGTSRT
HLSTHVGFGSFFCGTIAYWMTCRYQWSVRRFEQQQLREAMRRQALYEGTQ
RERDLDLKSA*

BS15274.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)87Df-PA 110 CG7620-PA 1..110 1..110 584 100 Plus