Clone Sequence Records
BS15431.5prime Sequence
249 bp (249 high quality bases) assembled on 2006-12-21
> BS15431.5prime
GAAGTTATCCTTCGACATGGATCCCAGTGCTCTACAAAACATGGATCGGG
ACGCATTAAAGAAGCAAATCGAGAATATGAAATATCAGGCCTCCATGGAG
CGCTGGCCGTTATCTAAATCCATAGCAGAAATGCGCTCGTTCATCGAGGA
GAACGAGAAAAATGATCCGTTGATCAATGCGCCGGATAAGAAGAACAATC
CATGGGCCGAAAAGGGCAAATGCGTTATTATGTAAAAGCTTTCTAGACC
BS15431.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:20:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3694-PA | 219 | Ggamma30A-RA | 1..219 | 17..235 | 1095 | 100 | Plus |
CG3694-PB | 219 | Ggamma30A-RB | 1..219 | 17..235 | 1095 | 100 | Plus |
CG3694-PC | 219 | Ggamma30A-RC | 1..219 | 17..235 | 1095 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 04:29:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma30A-RJ | 2995 | CG3694-RJ | 673..892 | 16..235 | 1100 | 100 | Plus |
Ggamma30A-RH | 4742 | CG3694-RH | 163..382 | 16..235 | 1100 | 100 | Plus |
Ggamma30A-RG | 1470 | CG3694-RG | 614..833 | 16..235 | 1100 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 04:29:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 9272494..9272607 | 16..129 | 570 | 100 | Plus |
2L | 23513712 | 2L | 9291056..9291161 | 130..235 | 530 | 100 | Plus |
Blast to na_te.dros performed 2015-01-30 04:29:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\Tv1 | 6868 | Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). | 1173..1235 | 114..178 | 104 | 64.6 | Plus |
BS15431.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:26:46 Download gff for
BS15431.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3694-PB | 1..219 | 17..235 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:03:31 Download gff for
BS15431.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3694-PC | 1..219 | 17..235 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-05 05:31:51 Download gff for
BS15431.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RG | 611..837 | 13..241 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 06:46:26 Download gff for
BS15431.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RG | 611..837 | 13..241 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 06:46:26 Download gff for
BS15431.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 9272491..9272607 | 13..129 | 99 | -> | Plus |
2L | 9291056..9291165 | 130..241 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-05 05:31:51 Download gff for
BS15431.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 9272491..9272607 | 13..129 | 99 | -> | Plus |
arm_2L | 9291056..9291165 | 130..241 | 97 | | Plus |
BS15431.3prime Sequence
249 bp (249 high quality bases) assembled on 2006-12-21
> BS15431.3prime
ATGGTCTAGAAAGCTTTTACATAATAACGCATTTGCCCTTTTCGGCCCAT
GGATTGTTCTTCTTATCCGGCGCATTGATCAACGGATCATTTTTCTCGTT
CTCCTCGATGAACGAGCGCATTTCTGCTATGGATTTAGATAACGGCCAGC
GCTCCATGGAGGCCTGATATTTCATATTCTCGATTTGCTTCTTTAATGCG
TCCCGATCCATGTTTTGTAGAGCACTGGGATCCATGTCGACTGATAACT
BS15431.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:20:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3694-PA | 219 | Ggamma30A-RA | 1..219 | 235..17 | 1095 | 100 | Minus |
CG3694-PB | 219 | Ggamma30A-RB | 1..219 | 235..17 | 1095 | 100 | Minus |
CG3694-PC | 219 | Ggamma30A-RC | 1..219 | 235..17 | 1095 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 07:23:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma30A-RJ | 2995 | CG3694-RJ | 673..892 | 236..17 | 1100 | 100 | Minus |
Ggamma30A-RH | 4742 | CG3694-RH | 163..382 | 236..17 | 1100 | 100 | Minus |
Ggamma30A-RG | 1470 | CG3694-RG | 614..833 | 236..17 | 1100 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 07:23:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 9272494..9272607 | 236..123 | 570 | 100 | Minus |
2L | 23513712 | 2L | 9291056..9291161 | 122..17 | 530 | 100 | Minus |
Blast to na_te.dros performed 2015-02-08 07:23:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\Tv1 | 6868 | Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). | 1173..1235 | 138..74 | 104 | 64.6 | Minus |
BS15431.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:26:44 Download gff for
BS15431.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3694-PB | 1..219 | 17..235 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:03:30 Download gff for
BS15431.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3694-PC | 1..219 | 17..235 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 22:23:51 Download gff for
BS15431.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RG | 602..837 | 11..249 | 96 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 08:21:53 Download gff for
BS15431.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RG | 602..837 | 11..249 | 96 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 08:21:53 Download gff for
BS15431.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 9272482..9272607 | 123..249 | 96 | -> | Minus |
2L | 9291056..9291165 | 11..122 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 22:23:51 Download gff for
BS15431.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 9272482..9272607 | 123..249 | 96 | -> | Minus |
arm_2L | 9291056..9291165 | 11..122 | 97 | | Minus |
BS15431.complete Sequence
251 bp assembled on 2006-11-29
GenBank Submission: FJ637934
> BS15431.complete
GAAGTTATCAGTCGACATGGATCCCAGTGCTCTACAAAACATGGATCGGG
ACGCATTAAAGAAGCAAATCGAGAATATGAAATATCAGGCCTCCATGGAG
CGCTGGCCGTTATCTAAATCCATAGCAGAAATGCGCTCGTTCATCGAGGA
GAACGAGAAAAATGATCCGTTGATCAATGCGCCGGATAAGAAGAACAATC
CATGGGCCGAAAAGGGCAAATGCGTTATTATGTAAAAGCTTTCTAGACCA
T
BS15431.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 07:53:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma30A-RJ | 717 | CG3694-PJ | 1..219 | 17..235 | 1095 | 100 | Plus |
Ggamma30A-RH | 219 | CG3694-PH | 1..219 | 17..235 | 1095 | 100 | Plus |
Ggamma30A-RG | 219 | CG3694-PG | 1..219 | 17..235 | 1095 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 07:53:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma30A-RJ | 2995 | CG3694-RJ | 673..892 | 16..235 | 1100 | 100 | Plus |
Ggamma30A-RH | 4742 | CG3694-RH | 163..382 | 16..235 | 1100 | 100 | Plus |
Ggamma30A-RG | 1470 | CG3694-RG | 614..833 | 16..235 | 1100 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 07:52:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 9272494..9272607 | 16..129 | 570 | 100 | Plus |
2L | 23513712 | 2L | 9291056..9291161 | 130..235 | 530 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 07:52:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\Tv1 | 6868 | Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). | 1173..1235 | 114..178 | 104 | 64.6 | Plus |
BS15431.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:32:27 Download gff for
BS15431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RC | 1..219 | 17..235 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:37:57 Download gff for
BS15431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RC | 676..892 | 17..233 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:12:25 Download gff for
BS15431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RG | 615..831 | 17..233 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:32:27 Download gff for
BS15431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RC | 662..898 | 2..241 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:05:54 Download gff for
BS15431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RG | 615..831 | 17..233 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:05:54 Download gff for
BS15431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 9272495..9272607 | 17..129 | 100 | -> | Plus |
2L | 9291056..9291159 | 130..233 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:12:25 Download gff for
BS15431.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 9272495..9272607 | 17..129 | 100 | -> | Plus |
arm_2L | 9291056..9291159 | 130..233 | 100 | | Plus |
BS15431.pep Sequence
Translation from 16 to 234
> BS15431.pep
MDPSALQNMDRDALKKQIENMKYQASMERWPLSKSIAEMRSFIEENEKND
PLINAPDKKNNPWAEKGKCVIM*
BS15431.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:23:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma30A-PH | 72 | CG3694-PH | 1..72 | 1..72 | 381 | 100 | Plus |
Ggamma30A-PG | 72 | CG3694-PG | 1..72 | 1..72 | 381 | 100 | Plus |
Ggamma30A-PF | 72 | CG3694-PF | 1..72 | 1..72 | 381 | 100 | Plus |
Ggamma30A-PC | 72 | CG3694-PC | 1..72 | 1..72 | 381 | 100 | Plus |
Ggamma30A-PB | 72 | CG3694-PB | 1..72 | 1..72 | 381 | 100 | Plus |