Clone BS15431 Report

Search the DGRC for BS15431

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:154
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptGgamma30A-RB
Protein status:BS15431.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS15431.5prime Sequence

249 bp (249 high quality bases) assembled on 2006-12-21

> BS15431.5prime
GAAGTTATCCTTCGACATGGATCCCAGTGCTCTACAAAACATGGATCGGG
ACGCATTAAAGAAGCAAATCGAGAATATGAAATATCAGGCCTCCATGGAG
CGCTGGCCGTTATCTAAATCCATAGCAGAAATGCGCTCGTTCATCGAGGA
GAACGAGAAAAATGATCCGTTGATCAATGCGCCGGATAAGAAGAACAATC
CATGGGCCGAAAAGGGCAAATGCGTTATTATGTAAAAGCTTTCTAGACC

BS15431.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG3694-PA 219 Ggamma30A-RA 1..219 17..235 1095 100 Plus
CG3694-PB 219 Ggamma30A-RB 1..219 17..235 1095 100 Plus
CG3694-PC 219 Ggamma30A-RC 1..219 17..235 1095 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 04:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma30A-RJ 2995 CG3694-RJ 673..892 16..235 1100 100 Plus
Ggamma30A-RH 4742 CG3694-RH 163..382 16..235 1100 100 Plus
Ggamma30A-RG 1470 CG3694-RG 614..833 16..235 1100 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 04:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9272494..9272607 16..129 570 100 Plus
2L 23513712 2L 9291056..9291161 130..235 530 100 Plus
Blast to na_te.dros performed 2015-01-30 04:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 1173..1235 114..178 104 64.6 Plus

BS15431.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:26:46 Download gff for BS15431.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3694-PB 1..219 17..235 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:03:31 Download gff for BS15431.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3694-PC 1..219 17..235 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-05 05:31:51 Download gff for BS15431.5prime
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RG 611..837 13..241 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 06:46:26 Download gff for BS15431.5prime
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RG 611..837 13..241 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 06:46:26 Download gff for BS15431.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 9272491..9272607 13..129 99 -> Plus
2L 9291056..9291165 130..241 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-05 05:31:51 Download gff for BS15431.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9272491..9272607 13..129 99 -> Plus
arm_2L 9291056..9291165 130..241 97   Plus

BS15431.3prime Sequence

249 bp (249 high quality bases) assembled on 2006-12-21

> BS15431.3prime
ATGGTCTAGAAAGCTTTTACATAATAACGCATTTGCCCTTTTCGGCCCAT
GGATTGTTCTTCTTATCCGGCGCATTGATCAACGGATCATTTTTCTCGTT
CTCCTCGATGAACGAGCGCATTTCTGCTATGGATTTAGATAACGGCCAGC
GCTCCATGGAGGCCTGATATTTCATATTCTCGATTTGCTTCTTTAATGCG
TCCCGATCCATGTTTTGTAGAGCACTGGGATCCATGTCGACTGATAACT

BS15431.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG3694-PA 219 Ggamma30A-RA 1..219 235..17 1095 100 Minus
CG3694-PB 219 Ggamma30A-RB 1..219 235..17 1095 100 Minus
CG3694-PC 219 Ggamma30A-RC 1..219 235..17 1095 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 07:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma30A-RJ 2995 CG3694-RJ 673..892 236..17 1100 100 Minus
Ggamma30A-RH 4742 CG3694-RH 163..382 236..17 1100 100 Minus
Ggamma30A-RG 1470 CG3694-RG 614..833 236..17 1100 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 07:23:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9272494..9272607 236..123 570 100 Minus
2L 23513712 2L 9291056..9291161 122..17 530 100 Minus
Blast to na_te.dros performed 2015-02-08 07:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 1173..1235 138..74 104 64.6 Minus

BS15431.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:26:44 Download gff for BS15431.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3694-PB 1..219 17..235 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:03:30 Download gff for BS15431.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3694-PC 1..219 17..235 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 22:23:51 Download gff for BS15431.3prime
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RG 602..837 11..249 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 08:21:53 Download gff for BS15431.3prime
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RG 602..837 11..249 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 08:21:53 Download gff for BS15431.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 9272482..9272607 123..249 96 -> Minus
2L 9291056..9291165 11..122 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 22:23:51 Download gff for BS15431.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9272482..9272607 123..249 96 -> Minus
arm_2L 9291056..9291165 11..122 97   Minus

BS15431.complete Sequence

251 bp assembled on 2006-11-29

GenBank Submission: FJ637934

> BS15431.complete
GAAGTTATCAGTCGACATGGATCCCAGTGCTCTACAAAACATGGATCGGG
ACGCATTAAAGAAGCAAATCGAGAATATGAAATATCAGGCCTCCATGGAG
CGCTGGCCGTTATCTAAATCCATAGCAGAAATGCGCTCGTTCATCGAGGA
GAACGAGAAAAATGATCCGTTGATCAATGCGCCGGATAAGAAGAACAATC
CATGGGCCGAAAAGGGCAAATGCGTTATTATGTAAAAGCTTTCTAGACCA
T

BS15431.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 07:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma30A-RJ 717 CG3694-PJ 1..219 17..235 1095 100 Plus
Ggamma30A-RH 219 CG3694-PH 1..219 17..235 1095 100 Plus
Ggamma30A-RG 219 CG3694-PG 1..219 17..235 1095 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 07:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma30A-RJ 2995 CG3694-RJ 673..892 16..235 1100 100 Plus
Ggamma30A-RH 4742 CG3694-RH 163..382 16..235 1100 100 Plus
Ggamma30A-RG 1470 CG3694-RG 614..833 16..235 1100 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 07:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9272494..9272607 16..129 570 100 Plus
2L 23513712 2L 9291056..9291161 130..235 530 100 Plus
Blast to na_te.dros performed 2014-11-28 07:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 1173..1235 114..178 104 64.6 Plus

BS15431.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:32:27 Download gff for BS15431.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RC 1..219 17..235 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:37:57 Download gff for BS15431.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RC 676..892 17..233 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:12:25 Download gff for BS15431.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RG 615..831 17..233 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:32:27 Download gff for BS15431.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RC 662..898 2..241 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:05:54 Download gff for BS15431.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RG 615..831 17..233 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:05:54 Download gff for BS15431.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9272495..9272607 17..129 100 -> Plus
2L 9291056..9291159 130..233 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:12:25 Download gff for BS15431.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9272495..9272607 17..129 100 -> Plus
arm_2L 9291056..9291159 130..233 100   Plus

BS15431.pep Sequence

Translation from 16 to 234

> BS15431.pep
MDPSALQNMDRDALKKQIENMKYQASMERWPLSKSIAEMRSFIEENEKND
PLINAPDKKNNPWAEKGKCVIM*

BS15431.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma30A-PH 72 CG3694-PH 1..72 1..72 381 100 Plus
Ggamma30A-PG 72 CG3694-PG 1..72 1..72 381 100 Plus
Ggamma30A-PF 72 CG3694-PF 1..72 1..72 381 100 Plus
Ggamma30A-PC 72 CG3694-PC 1..72 1..72 381 100 Plus
Ggamma30A-PB 72 CG3694-PB 1..72 1..72 381 100 Plus