Clone BS15649 Report

Search the DGRC for BS15649

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:156
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG13631-RA
Protein status:BS15649.pep: full length peptide match
Sequenced Size:284

Clone Sequence Records

BS15649.complete Sequence

284 bp assembled on 2010-02-09

GenBank Submission: KX801762

> BS15649.complete
GAAGTTATCAGTTGACATGTCGCATCAGTGCAGCTGCGGTCGCGACCTCA
ACAACAACTACGTCTCGTACACCAACGCCTACGCCAATGCGAATGCATCT
CTGGACCGCGAGGCGGCCACCAGCGGCAAGTCCGGCGGTCCGCCCCGCGC
CCAGCTGACGGCCAAGGTGATGTTCGGTACGGTGGGCGCCATCAAGGAGC
TGCGCGACAAGGAGCAGCAGCAACAGCAGCAGCGGCAGGCGGCACGAGCG
GGCGAGAGGCGCAACTGAAAGCTTTCTAGACCAT

BS15649.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:33:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-RB 252 CG13631-PB 1..252 17..268 1260 100 Plus
CG13631-RA 252 CG13631-PA 1..252 17..268 1260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-RB 1583 CG13631-RB 170..423 15..268 1270 100 Plus
CG13631-RA 761 CG13631-RA 170..423 15..268 1270 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24769520..24769773 15..268 1270 100 Plus
Blast to na_te.dros performed 2014-11-28 04:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6813..6865 195..248 131 78.2 Plus
roo 9092 roo DM_ROO 9092bp 1068..1124 210..265 129 74.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6780..6835 195..251 128 75.9 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 909..1030 130..249 128 60.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6759..6814 195..251 119 74.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6738..6791 195..249 118 75 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2353..2391 210..249 116 80 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6770 204..249 116 78.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2794..2841 195..242 114 70.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6824..6884 190..249 112 73 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2335..2372 213..251 111 79.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6783..6839 210..265 111 70.7 Plus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 7956..7998 207..247 111 76.7 Plus
TART-C 11124 TART-C TARTC 11124bp 9400..9442 207..247 111 76.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2629..2659 207..237 110 83.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2455..2483 210..238 109 86.2 Plus
roo 9092 roo DM_ROO 9092bp 1094..1138 194..238 108 71.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2353..2395 195..237 107 72.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..6780 213..269 107 69.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1558..1589 213..244 106 81.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6741..6801 210..269 104 67.7 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 153..199 213..257 104 72.3 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9183..9229 213..257 104 72.3 Plus
roo 9092 roo DM_ROO 9092bp 1116..1141 213..238 103 88.5 Plus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 669..770 267..166 103 60.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2806..2857 213..266 102 70.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6762..6818 210..265 102 69 Plus
roo 9092 roo DM_ROO 9092bp 1089..1145 210..265 102 69 Plus
roo 9092 roo DM_ROO 9092bp 1104..1141 213..251 102 76.9 Plus

BS15649.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:12:17 Download gff for BS15649.complete
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 170..420 17..267 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:01:54 Download gff for BS15649.complete
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 172..422 17..267 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:24:10 Download gff for BS15649.complete
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 170..420 17..267 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:31:39 Download gff for BS15649.complete
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 172..422 17..267 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:31:39 Download gff for BS15649.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24769522..24769772 17..267 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:01:54 Download gff for BS15649.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20595244..20595494 17..267 100   Plus

BS15649.5prime Sequence

282 bp (282 high quality bases) assembled on 2006-12-21

> BS15649.5prime
GAAGTTATCCTTCGAGGTGTCGCATCAGTGCAGCTGCGGTCGCGACCTCA
ACAACAACTACGTCTCGTACACCAACGCCTACGCCTATGCGAATGCATCT
CTGGACCGCGAGGCGGCCACCAGCGGCAAGTCCGGCGGTCCGCCCCGCGC
CCAGCTGACGGCCAAGGTGATGTTCGGTACGGTGGGCGCCATCAAGGAGC
TGCGCGACAAGGAGCAGCAGCAACAGCAGCAGCGGCAGGCGGCACGAGCG
GGCGAGAGGCGCAACTGAAAGCTTTCTAGACC

BS15649.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:25:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-PA 252 CG13631-RA 2..252 18..268 1230 99.6 Plus
CG31247-PD 4542 tinc-RD 3188..3215 213..240 140 100 Plus
CG31247-PA 4542 tinc-RA 3188..3215 213..240 140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-RB 1583 CG13631-RB 173..423 18..268 1240 99.6 Plus
CG13631-RA 761 CG13631-RA 173..423 18..268 1240 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 18:30:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24769523..24769773 18..268 1240 99.6 Plus
Blast to na_te.dros performed 2015-02-10 18:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6813..6865 195..248 131 78.2 Plus
roo 9092 roo DM_ROO 9092bp 1068..1124 210..265 129 74.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6780..6835 195..251 128 75.9 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 909..1030 130..249 128 60.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6759..6814 195..251 119 74.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6738..6791 195..249 118 75 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2353..2391 210..249 116 80 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6770 204..249 116 78.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2794..2841 195..242 114 70.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6824..6884 190..249 112 73 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2335..2372 213..251 111 79.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6783..6839 210..265 111 70.7 Plus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 7956..7998 207..247 111 76.7 Plus
TART-C 11124 TART-C TARTC 11124bp 9400..9442 207..247 111 76.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2629..2659 207..237 110 83.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2455..2483 210..238 109 86.2 Plus
roo 9092 roo DM_ROO 9092bp 1094..1138 194..238 108 71.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2353..2395 195..237 107 72.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..6780 213..269 107 69.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1558..1589 213..244 106 81.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6741..6801 210..269 104 67.7 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 153..199 213..257 104 72.3 Plus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9183..9229 213..257 104 72.3 Plus
roo 9092 roo DM_ROO 9092bp 1116..1141 213..238 103 88.5 Plus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 669..770 267..166 103 60.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2806..2857 213..266 102 70.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6762..6818 210..265 102 69 Plus
roo 9092 roo DM_ROO 9092bp 1089..1145 210..265 102 69 Plus
roo 9092 roo DM_ROO 9092bp 1104..1141 213..251 102 76.9 Plus

BS15649.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:33:01 Download gff for BS15649.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13631-PA 2..252 18..268 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:11:39 Download gff for BS15649.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13631-PA 2..252 18..268 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 13:02:43 Download gff for BS15649.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 173..426 18..271 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:03:00 Download gff for BS15649.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 173..426 18..271 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 20:03:00 Download gff for BS15649.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 24769523..24769776 18..271 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 13:02:43 Download gff for BS15649.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20595245..20595498 18..271 99   Plus

BS15649.3prime Sequence

282 bp (282 high quality bases) assembled on 2006-12-21

> BS15649.3prime
ATGGNCAAGAAACCTTTCTCCTTTGCGTCTCGCCCGCTCGTGCCGCCTGC
CGCTGCTGCTGTTGCTGCTGCTCCTTGTCGCGCAGCTCCTTGATTCCGCC
CACCGTACCGAACATCACCTTGGCCGTCAGCTGGGCGCGGGGCGGACCGC
CGGACTTGCCGCTGGTGGCCGCCTCGCGGTCCAGAGATGCATTCGCATTG
GCGTAGGCGTTGGTGTACGAGACGTAGTTGTTGTTGAGGTCGCGACCGCA
GCTGCACTGATGCGACATGTCAACTGATAACT

BS15649.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-PA 252 CG13631-RA 1..241 268..28 1155 99.1 Minus
CG31247-PD 4542 tinc-RD 3188..3215 72..45 140 100 Minus
CG31247-PA 4542 tinc-RA 3188..3215 72..45 140 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-RB 1583 CG13631-RB 170..412 270..28 1185 99.2 Minus
CG13631-RA 761 CG13631-RA 170..412 270..28 1185 99.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24769520..24769762 270..28 1185 99.2 Minus
Blast to na_te.dros performed 2015-02-11 15:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6813..6865 90..37 131 78.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6780..6835 90..34 128 75.9 Minus
gypsy11 4428 gypsy11 GYPSY11 4428bp 909..1050 155..13 127 60.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6759..6831 90..17 123 68 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6738..6791 90..36 118 75 Minus
roo 9092 roo DM_ROO 9092bp 1068..1108 75..34 117 78.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2353..2391 75..36 116 80 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6770 81..36 116 78.3 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2794..2841 90..43 114 70.8 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2335..2372 72..34 111 79.5 Minus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 7956..7998 78..38 111 76.7 Minus
TART-C 11124 TART-C TARTC 11124bp 9400..9442 78..38 111 76.7 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6831..6884 90..36 110 69.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2629..2659 78..48 110 83.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2455..2483 75..47 109 86.2 Minus
roo 9092 roo DM_ROO 9092bp 1090..1141 99..47 109 69.8 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2353..2395 90..48 107 72.1 Minus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 676..770 24..119 107 60.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1558..1589 72..41 106 81.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6783..6824 75..36 106 76.2 Minus
roo 9092 roo DM_ROO 9092bp 1104..1158 72..17 106 67.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..6772 72..23 105 72.5 Minus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 153..199 72..28 104 72.3 Minus
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 9183..9229 72..28 104 72.3 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6741..6793 75..23 102 70.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2806..2846 72..34 101 75.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6762..6790 75..47 100 82.8 Minus
roo 9092 roo DM_ROO 9092bp 1089..1117 75..47 100 82.8 Minus

BS15649.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:33:00 Download gff for BS15649.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13631-PA 1..252 19..268 97   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:11:37 Download gff for BS15649.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13631-PA 1..252 19..268 97   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 03:48:44 Download gff for BS15649.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 160..425 17..278 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:31:07 Download gff for BS15649.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 160..425 17..278 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:31:07 Download gff for BS15649.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 24769510..24769775 17..278 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 03:48:44 Download gff for BS15649.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20595232..20595497 17..278 96   Minus

BS15649.pep Sequence

Translation from 16 to 267

> BS15649.pep
MSHQCSCGRDLNNNYVSYTNAYANANASLDREAATSGKSGGPPRAQLTAK
VMFGTVGAIKELRDKEQQQQQQRQAARAGERRN*

BS15649.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-PB 83 CG13631-PB 1..83 1..83 428 100 Plus
CG13631-PA 83 CG13631-PA 1..83 1..83 428 100 Plus