Clone BS15662 Report

Search the DGRC for BS15662

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:156
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptCG31517-RA
Protein status:BS15662.pep: full length peptide match
Sequenced Size:224

Clone Sequence Records

BS15662.complete Sequence

224 bp assembled on 2010-02-09

GenBank Submission: KX803960

> BS15662.complete
GAAGTTATCAGTCGACATGTCGTGGCGACGGTACGTGCGGCCAAACAAAT
TACAGGGAAATTGCGTCACCTGCAGGAATTTCCACTCGACATTGTCAAAT
GCCATCAGAAATCGCTGGACATGTTGTAACATTAATTTGACATTTTACGG
CCCAGGACGGGGATCGTCGACGGGAATGAGACCGCAGAGCAACGCAGGAC
AACGTTAAAAGCTTTCTAGACCAT

BS15662.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-RB 192 CG31517-PB 1..192 17..208 960 100 Plus
CG31517-RA 192 CG31517-PA 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-RB 1185 CG31517-RB 415..608 16..209 970 100 Plus
CG31517-RA 827 CG31517-RA 415..608 16..209 970 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13948834..13948998 16..180 825 100 Plus
Blast to na_te.dros performed on 2014-11-27 12:52:32 has no hits.

BS15662.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:10:44 Download gff for BS15662.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 401..590 17..206 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:25:13 Download gff for BS15662.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 401..590 17..206 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:04:01 Download gff for BS15662.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 401..590 17..206 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:06:31 Download gff for BS15662.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 416..605 17..206 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:06:31 Download gff for BS15662.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13948835..13948998 17..180 100 -> Plus
3R 13949083..13949108 181..206 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:25:13 Download gff for BS15662.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9774557..9774720 17..180 100 -> Plus
arm_3R 9774805..9774830 181..206 100   Plus

BS15662.3prime Sequence

222 bp (222 high quality bases) assembled on 2006-12-21

> BS15662.3prime
ATGGTCTAGAAAGCTTTTACCTTTGTCCTGCGTTGCTCTGCGGTCTCATT
CCCGTCGACGATCCCCGTCCTGGGCCGTAAAATGTCAAATTAATGTTACA
ACATGTCCAGCGATTTCTGATGGCATTTGACAATGTCGAGTGGAAATTCC
TGCAGGTGACGCAATTTCCCTGTAATTTGTTTGGCCGCACGTACCGTCGC
CACGACATGTCGACTGATAACT

BS15662.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-PA 192 CG31517-RA 1..186 208..23 930 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:26:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-RB 1185 CG31517-RB 415..608 209..16 940 99 Minus
CG31517-RA 827 CG31517-RA 415..608 209..16 940 99 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13948834..13948998 209..45 825 100 Minus
Blast to na_te.dros performed on 2015-02-10 15:26:31 has no hits.

BS15662.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:33:21 Download gff for BS15662.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31517-PA 1..192 17..208 98   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:12:06 Download gff for BS15662.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31517-PA 1..192 17..208 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 21:29:43 Download gff for BS15662.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 400..593 16..209 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:52:18 Download gff for BS15662.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 415..608 16..209 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 17:52:18 Download gff for BS15662.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 13948834..13948998 45..209 100 -> Minus
3R 13949083..13949111 16..44 93   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 21:29:43 Download gff for BS15662.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9774556..9774720 45..209 100 -> Minus
arm_3R 9774805..9774833 16..44 93   Minus

BS15662.5prime Sequence

222 bp (222 high quality bases) assembled on 2006-12-21

> BS15662.5prime
GAAGTTATCCTTCGACATGTCGTGGCGACGGTACGTGCGGCCAAACAAAT
TACAGGGAAATTGCGTCACCTGCAGGAATTTCCACTCGACATTGTCAAAT
GCCATCAGAAATCGCTGGACATGTTGTAACATTAATTTGACATTTTACGG
CCCAGGACGGGGATCGTCGACGGGAATGAGACCGCAGAGCAACGCAGGAC
AACGTTAAAAGCTTTCTAGACC

BS15662.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:25:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-PA 192 CG31517-RA 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:22:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-RB 1185 CG31517-RB 415..608 16..209 970 100 Plus
CG31517-RA 827 CG31517-RA 415..608 16..209 970 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:22:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13948834..13948998 16..180 825 100 Plus
Blast to na_te.dros performed on 2015-02-12 17:22:12 has no hits.

BS15662.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:33:22 Download gff for BS15662.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31517-PA 1..192 17..208 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:12:07 Download gff for BS15662.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31517-PA 1..192 17..208 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 23:32:57 Download gff for BS15662.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 400..593 16..209 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:29:48 Download gff for BS15662.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 415..608 16..209 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:29:48 Download gff for BS15662.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 13948834..13948998 16..180 100 -> Plus
3R 13949083..13949111 181..209 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 23:32:57 Download gff for BS15662.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9774556..9774720 16..180 100 -> Plus
arm_3R 9774805..9774833 181..209 100   Plus

BS15662.pep Sequence

Translation from 16 to 207

> BS15662.pep
MSWRRYVRPNKLQGNCVTCRNFHSTLSNAIRNRWTCCNINLTFYGPGRGS
STGMRPQSNAGQR*

BS15662.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-PB 63 CG31517-PB 1..63 1..63 357 100 Plus
CG31517-PA 63 CG31517-PA 1..63 1..63 357 100 Plus