Clone BS15664 Report

Search the DGRC for BS15664

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:156
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptCG10570-RA
Protein status:BS15664.pep: full length peptide match
Sequenced Size:254

Clone Sequence Records

BS15664.3prime Sequence

252 bp (252 high quality bases) assembled on 2006-12-21

> BS15664.3prime
ATGGTCTAGAAAGCTTTTCCCTTTAATGCATCCCATTGAATTGCTGGCGA
TCGGTTTTCACCATGTTGTTGTACTTCCACTTGTCAGCACTCGATGCTTG
ACTGCTCCAAGATCCCGATCCTGATCCCGAACCCGATCCAGAGCCGCTGC
TCGACTTGGAGTGGTTCTGACCCTTCGTGGACTGGTTGTCCTTTGTGGTG
CTGCTCAGGCACTTGTCGGTACGTTCGGTGTAGACCATGTCGACTGATAA
CT

BS15664.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:25:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG10570-PA 222 CG10570-RA 1..214 238..25 1070 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 12:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG42502-RB 1083 CG42502-RB 637..850 238..25 1070 100 Minus
CG42502-RA 817 CG42502-RA 371..584 238..25 1070 100 Minus
CG42502-RC 2159 CG42502-RC 371..584 238..25 1070 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 12:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18810269..18810482 25..238 1070 100 Plus
Blast to na_te.dros performed on 2015-01-30 12:33:54 has no hits.

BS15664.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:33:26 Download gff for BS15664.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10570-PA 1..214 25..238 100   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:12:13 Download gff for BS15664.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10570-PA 1..214 25..238 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-05 09:38:50 Download gff for BS15664.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10570-RB 627..850 25..249 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 14:03:02 Download gff for BS15664.3prime
Subject Subject Range Query Range Percent Splice Strand
CG42502-RC 361..584 25..249 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 14:03:02 Download gff for BS15664.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 18810269..18810492 25..249 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-05 09:38:50 Download gff for BS15664.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18810269..18810492 25..249 97   Plus

BS15664.5prime Sequence

252 bp (252 high quality bases) assembled on 2006-12-21

> BS15664.5prime
GAAGTTATCCTTCGACATGGTCTACACCGAACGTACCGACAAGTGCCTGA
GCAGCACCACAAAGGACAACCAGTCCACGAAGGGTCAGAACCACTCCAAG
TCGAGCAGCGGCTCTGGATCGGGTTCGGGATCAGGATCGGGATCTTGGAG
CAGTCAAGCATCGAGTGCTGACAAGTGGAAGTACAACAACATGGTGAAAA
CCGATCGCCAGCAATTCAATGGGATGCATTTCTCCTAAAAGCTTTCTAGA
CC

BS15664.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:25:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG10570-PA 222 CG10570-RA 1..222 17..238 1110 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 00:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG42502-RB 1083 CG42502-RB 637..865 17..245 1130 99.6 Plus
CG42502-RA 817 CG42502-RA 371..599 17..245 1130 99.6 Plus
CG42502-RC 2159 CG42502-RC 371..599 17..245 1130 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 00:14:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18810254..18810482 245..17 1130 99.6 Minus
Blast to na_te.dros performed on 2015-02-06 00:14:29 has no hits.

BS15664.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:33:27 Download gff for BS15664.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10570-PA 1..222 17..238 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:12:14 Download gff for BS15664.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10570-PA 1..222 17..238 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 03:35:51 Download gff for BS15664.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10570-RB 637..873 17..252 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 00:36:09 Download gff for BS15664.5prime
Subject Subject Range Query Range Percent Splice Strand
CG42502-RC 371..607 17..252 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 00:36:09 Download gff for BS15664.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 18810245..18810482 17..252 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 03:35:51 Download gff for BS15664.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18810245..18810482 17..252 98   Minus

BS15664.complete Sequence

254 bp assembled on 2009-08-24

GenBank Submission: KX804162

> BS15664.complete
GAAGTTATCAGTCGACATGGTCTACACCGAACGTACCGACAAGTGCCTGA
GCAGCACCACAAAGGACAACCAGTCCACGAAGGGTCAGAACCACTCCAAG
TCGAGCAGCGGCTCTGGATCGGGTTCGGGATCAGGATCGGGATCTTGGAG
CAGTCAAGCATCGAGTGCTGACAAGTGGAAGTACAACAACATGGTGAAAA
CCGATCGCCAGCAATTCAATGGGATGCATTTCTCCTAAAAGCTTTCTAGA
CCAT

BS15664.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG10570-RB 222 CG10570-PB 1..222 17..238 1110 100 Plus
CG10570-RC 222 CG10570-PC 1..222 17..238 1110 100 Plus
CG10570-RA 222 CG10570-PA 1..222 17..238 1110 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG42502-RB 1083 CG42502-RB 637..865 17..245 1130 99.6 Plus
CG42502-RA 817 CG42502-RA 371..599 17..245 1130 99.6 Plus
CG42502-RC 2159 CG42502-RC 371..599 17..245 1130 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:32:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18810254..18810482 245..17 1130 99.6 Minus
Blast to na_te.dros performed on 2014-11-28 01:32:22 has no hits.

BS15664.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-26 17:02:46 Download gff for BS15664.complete
Subject Subject Range Query Range Percent Splice Strand
CG10570-RA 371..590 17..236 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:50:30 Download gff for BS15664.complete
Subject Subject Range Query Range Percent Splice Strand
CG10570-RB 637..856 17..236 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:50:59 Download gff for BS15664.complete
Subject Subject Range Query Range Percent Splice Strand
CG42502-RC 371..590 17..236 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 02:50:59 Download gff for BS15664.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18810263..18810482 17..236 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:50:30 Download gff for BS15664.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18810263..18810482 17..236 100   Minus

BS15664.pep Sequence

Translation from 16 to 237

> BS15664.pep
MVYTERTDKCLSSTTKDNQSTKGQNHSKSSSGSGSGSGSGSGSWSSQASS
ADKWKYNNMVKTDRQQFNGMHFS*

BS15664.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG10570-PB 73 CG10570-PB 1..73 1..73 387 100 Plus
CG10570-PC 73 CG10570-PC 1..73 1..73 387 100 Plus
CG10570-PA 73 CG10570-PA 1..73 1..73 387 100 Plus