Clone BS15747 Report

Search the DGRC for BS15747

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:157
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptTim10-RA
Protein status:BS15747.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS15747.5prime Sequence

309 bp (309 high quality bases) assembled on 2006-12-21

> BS15747.5prime
GAAGTTATCAGTCGACATGGCATTGCCCCAGATCAGCACCGCAGACCAGG
CCAAGCTGCAGCTGATGCAGGAAATGGAGATCGAAATGATGTCCGATTTA
TATAACCGCATGACGAACGCTTGCCACAAAAAGTGCATTCCGCCGCGCTA
CTCCGAGTCGGAGTTGGGCAAAGGCGAGATGGTGTGCATCGATCGCTGTG
TGGCCAAATATCTGGACATTCACGAGAAGATCGGCAAGAAGCTGACGGCC
ATGTCCATGCAGGACGAGGAGCTGATGAAGAAGATGTCTAGTTAAAAGCT
TTCTAGACC

BS15747.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:27:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG9878-PB 279 Tim10-RB 1..279 17..295 1395 100 Plus
CG9878-PA 279 Tim10-RA 1..279 17..295 1395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 14:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
Tim10-RA 691 CG9878-RA 281..559 17..295 1395 100 Plus
Tim10-RB 762 CG9878-RB 352..630 17..295 1395 100 Plus
CG42497-RA 691 CG42497-RA 281..559 17..295 1395 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 14:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21690637..21690788 168..17 760 100 Minus
2R 25286936 2R 21690347..21690475 295..167 645 100 Minus
Blast to na_te.dros performed 2015-02-10 14:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy4 6852 gypsy4 GYPSY4 6852bp 6386..6442 99..44 138 73.7 Minus

BS15747.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:36:13 Download gff for BS15747.5prime
Subject Subject Range Query Range Percent Splice Strand
Tim10-PB 1..279 17..295 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:15:48 Download gff for BS15747.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9878-PA 1..279 17..295 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 21:22:57 Download gff for BS15747.5prime
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 275..562 9..300 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:48:40 Download gff for BS15747.5prime
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 275..562 9..300 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 17:48:40 Download gff for BS15747.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 21690344..21690474 168..300 97 <- Minus
2R 21690638..21690792 9..167 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 21:22:57 Download gff for BS15747.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17577849..17577979 168..300 97 <- Minus
arm_2R 17578143..17578297 9..167 97   Minus

BS15747.complete Sequence

311 bp assembled on 2006-11-29

GenBank Submission: FJ637956

> BS15747.complete
GAAGTTATCAGTCGACATGGCATTGCCCCAGATCAGCACCGCAGACCAGG
CCAAGCTGCAGCTGATGCAGGAAATGGAGATCGAAATGATGTCCGATTTA
TATAACCGCATGACGAACGCTTGCCACAAAAAGTGCATTCCGCCGCGCTA
CTCCGAGTCGGAGTTGGGCAAAGGCGAGATGGTGTGCATCGATCGCTGTG
TGGCCAAATATCTGGACATTCACGAGAAGATCGGCAAGAAGCTGACGGCC
ATGTCCATGCAGGACGAGGAGCTGATGAAGAAGATGTCTAGTTAAAAGCT
TTCTAGACCAT

BS15747.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
Tim10-RA 279 CG9878-PA 1..279 17..295 1395 100 Plus
Tim10-RB 279 CG9878-PB 1..279 17..295 1395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
Tim10-RA 691 CG9878-RA 281..559 17..295 1395 100 Plus
Tim10-RB 762 CG9878-RB 352..630 17..295 1395 100 Plus
CG42497-RA 691 CG42497-RA 281..559 17..295 1395 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:00:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21690637..21690788 168..17 760 100 Minus
2R 25286936 2R 21690347..21690475 295..167 645 100 Minus
Blast to na_te.dros performed 2014-11-27 07:00:49
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy4 6852 gypsy4 GYPSY4 6852bp 6386..6442 99..44 138 73.7 Minus

BS15747.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:38:15 Download gff for BS15747.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RA 1..279 17..295 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:16:20 Download gff for BS15747.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RB 271..558 9..300 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:02:22 Download gff for BS15747.complete
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 281..557 17..293 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:38:15 Download gff for BS15747.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RB 271..558 9..300 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:00:47 Download gff for BS15747.complete
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 281..557 17..293 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:00:47 Download gff for BS15747.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21690349..21690474 168..293 100 <- Minus
2R 21690638..21690788 17..167 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:02:22 Download gff for BS15747.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17577854..17577979 168..293 100 <- Minus
arm_2R 17578143..17578293 17..167 100   Minus

BS15747.3prime Sequence

309 bp (309 high quality bases) assembled on 2006-12-21

> BS15747.3prime
ATGGTCTAGAAAGCTTTTAACTATACATCTTCTTCATCAGCTCCTCGTCC
TGCATGGACATGGCCGTCAGCTTCTTGCCGATCTTCTCGTGAATGTCCAG
ATATTTGGCCACACAGCGATCGATGCACACCATCTCGCCTTTGCCCAACT
CCGACTCGGAGTAGCGCGGCGGAATGCACTTTTTGTGGCAAGCGTTCGTC
ATGCGGTTATATAAATCGGACATCATTTCGATCTCCATTTCCTGCATCAG
CTGCAGCTTGGCCTGGTCTGCGGTGCTGATCTGGGGCAATGCCATGTCGA
CTGATAACT

BS15747.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:27:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG9878-PB 279 Tim10-RB 1..279 295..17 1370 99.6 Minus
CG9878-PA 279 Tim10-RA 1..279 295..17 1370 99.6 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:05:24
Subject Length Description Subject Range Query Range Score Percent Strand
Tim10-RA 691 CG9878-RA 281..559 295..17 1380 99.6 Minus
Tim10-RB 762 CG9878-RB 352..630 295..17 1380 99.6 Minus
CG42497-RA 691 CG42497-RA 281..559 295..17 1380 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21690637..21690788 144..295 760 100 Plus
2R 25286936 2R 21690347..21690475 17..145 630 99.2 Plus
Blast to na_te.dros performed 2015-02-10 17:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy4 6852 gypsy4 GYPSY4 6852bp 6386..6442 213..268 138 73.7 Plus

BS15747.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:36:12 Download gff for BS15747.3prime
Subject Subject Range Query Range Percent Splice Strand
Tim10-PB 1..279 17..295 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:15:46 Download gff for BS15747.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9878-PA 1..279 17..295 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 18:33:51 Download gff for BS15747.3prime
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 275..562 12..303 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:27:32 Download gff for BS15747.3prime
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 275..562 12..303 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:27:32 Download gff for BS15747.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 21690344..21690474 12..144 96 <- Plus
2R 21690638..21690792 145..303 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 18:33:51 Download gff for BS15747.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17577849..17577979 12..144 96 <- Plus
arm_2R 17578143..17578297 145..303 97   Plus

BS15747.pep Sequence

Translation from 16 to 294

> BS15747.pep
MALPQISTADQAKLQLMQEMEIEMMSDLYNRMTNACHKKCIPPRYSESEL
GKGEMVCIDRCVAKYLDIHEKIGKKLTAMSMQDEELMKKMSS*

BS15747.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
Tim10-PA 92 CG9878-PA 1..92 1..92 475 100 Plus
Tim10-PB 92 CG9878-PB 1..92 1..92 475 100 Plus