Clone BS15750 Report

Search the DGRC for BS15750

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:157
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptCG8012-RA
Protein status:BS15750.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS15750.3prime Sequence

279 bp (279 high quality bases) assembled on 2006-12-21

> BS15750.3prime
ATGGTCTAGAAAGCTTTCACCCTCCTAGATACGAGTAGTATGGATACGTG
GCGTATGCGCCATAAACCGGTGCATACGCATACGCCGCGTAGGCCTCTTA
GCTGGCATACGCCGGATAGTAAGCGGCGGAGGAGGGAGCCAGCCAAGAGG
CACCCGCTCCGGTGGCATAACTCACTGGCGTCGTGACCAACAGCTGGGGC
TTCGCCTGGCTCAGGGCCACGAGCCACAATGCGAACATCAAGACCTTGAC
CAACATGACTCCCATGTCGACTGATAACT

BS15750.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG8012-PA 249 CG8012-RA 1..167 265..99 835 100 Minus
CG8012-PA 249 CG8012-RA 171..242 95..24 360 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG8012-RB 851 CG8012-RB 223..472 265..16 1175 98 Minus
CG8012-RA 461 CG8012-RA 72..321 265..16 1175 98 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8215599..8215819 236..16 1030 97.7 Minus
Blast to na_te.dros performed on 2015-02-10 17:04:27 has no hits.

BS15750.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:36:17 Download gff for BS15750.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8012-PA 1..249 17..265 97   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:15:53 Download gff for BS15750.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8012-PA 1..249 17..265 97   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 18:33:47 Download gff for BS15750.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 63..325 12..279 95   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:27:27 Download gff for BS15750.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 63..325 12..279 95   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:27:27 Download gff for BS15750.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 8215600..8215823 12..235 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 18:33:47 Download gff for BS15750.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8208700..8208923 12..235 96   Minus

BS15750.5prime Sequence

279 bp (279 high quality bases) assembled on 2006-12-21

> BS15750.5prime
GAAGTTATCCTTCGACATGGGAGTCATGTTGGTCAAGGTCTTGATGTTCG
CATTGTGGCTCGTGGCCCTGAGCCAGGCGAAGCCCCAGCTGTTGGTCACG
ACGCCAGTGAGTTATGCCACCGGAGCGGGTGCCTCTTGGCTGGCTCCCTC
CTCCGCCGCTTACTATCCGGCGTATGCCAGCTATCCGGCCTACGCGGCGT
ATGCGTATGCACCGGTTTATGGCGCATACGCCACGTATCCATACTACTCG
TATCTAGGGCGGTGAAAGCTTTCTAGACC

BS15750.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG8012-PA 249 CG8012-RA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG8012-RB 851 CG8012-RB 223..472 17..266 1250 100 Plus
CG8012-RA 461 CG8012-RA 72..321 17..266 1250 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8215599..8215819 46..266 1105 100 Plus
Blast to na_te.dros performed on 2015-02-10 16:39:29 has no hits.

BS15750.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:36:19 Download gff for BS15750.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8012-PA 1..249 17..265 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:15:55 Download gff for BS15750.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8012-PA 1..249 17..265 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 18:31:53 Download gff for BS15750.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 68..328 12..274 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:24:27 Download gff for BS15750.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 68..328 12..274 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:24:27 Download gff for BS15750.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 8215498..8215531 12..46 97 -> Plus
3L 8215600..8215826 47..274 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 18:31:53 Download gff for BS15750.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8208598..8208631 12..46 97 -> Plus
arm_3L 8208700..8208926 47..274 98   Plus

BS15750.complete Sequence

281 bp assembled on 2006-11-29

GenBank Submission: FJ637957

> BS15750.complete
GAAGTTATCAGTCGACATGGGAGTCATGTTGGTCAAGGTCTTGATGTTCG
CATTGTGGCTCGTGGCCCTGAGCCAGGCGAAGCCCCAGCTGTTGGTCACG
ACGCCAGTGAGTTATGCCACCGGAGCGGGTGCCTCTTGGCTGGCTCCCTC
CTCCGCCGCTTACTATCCGGCGTATGCCAGCTATCCGGCCTACGCGGCGT
ATGCGTATGCACCGGTTTATGGCGCATACGCCACGTATCCATACTACTCG
TATCTAGGGCGGTGAAAGCTTTCTAGACCAT

BS15750.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:41:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG8012-RB 249 CG8012-PB 1..249 17..265 1245 100 Plus
CG8012-RA 249 CG8012-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG8012-RB 851 CG8012-RB 223..472 17..266 1250 100 Plus
CG8012-RA 461 CG8012-RA 72..321 17..266 1250 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8215599..8215819 46..266 1105 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:41:57 has no hits.

BS15750.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:44:57 Download gff for BS15750.complete
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 1..249 17..265 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:31:19 Download gff for BS15750.complete
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 63..328 3..274 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:57:57 Download gff for BS15750.complete
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 72..319 17..264 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:44:58 Download gff for BS15750.complete
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 63..328 3..274 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:24:39 Download gff for BS15750.complete
Subject Subject Range Query Range Percent Splice Strand
CG8012-RA 72..319 17..264 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:24:39 Download gff for BS15750.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8215502..8215531 17..46 100 -> Plus
3L 8215600..8215817 47..264 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:57:57 Download gff for BS15750.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8208602..8208631 17..46 100 -> Plus
arm_3L 8208700..8208917 47..264 100   Plus

BS15750.pep Sequence

Translation from 16 to 264

> BS15750.pep
MGVMLVKVLMFALWLVALSQAKPQLLVTTPVSYATGAGASWLAPSSAAYY
PAYASYPAYAAYAYAPVYGAYATYPYYSYLGR*

BS15750.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG8012-PB 82 CG8012-PB 1..82 1..82 429 100 Plus
CG8012-PA 82 CG8012-PA 1..82 1..82 429 100 Plus