Clone BS15754 Report

Search the DGRC for BS15754

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:157
Well:54
Vector:pDNR-Dual
Associated Gene/TranscriptRpS27-RA
Protein status:BS15754.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS15754.3prime Sequence

285 bp (285 high quality bases) assembled on 2006-12-21

> BS15754.3prime
ATGGTCTAGAAAGCTTTTACCTTGGCTTCCTGCGGAAGGAGCAGCCTTCT
GTCAGCTTGGCGCGTCCTCCAGTCGGCTGGCACAAAATGGTAGCGCATCC
AGCGCAGACCACGACGCCTTGGGCGTGGCTGAAGACGGTGGTGATCCTGT
AGCAGCCGGGGCACTTCACGTCCATGAAGTACGAGTTGGGGTGCTGGACC
AGGCGCTTCAGCTTGTGCTTGCGCTTCTCCTCGGCGGGCAGAGGGTGCAG
AAGATCTTTTGCTAGCGGCATGTCGACTGATAACT

BS15754.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG10423-PA 255 RpS27-RA 1..249 271..23 1245 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
RpS27-RB 687 CG10423-RB 33..291 273..15 1265 99.2 Minus
RpS27-RA 729 CG10423-RA 75..333 273..15 1265 99.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25246447..25246672 45..270 1115 99.6 Plus
Blast to na_te.dros performed on 2015-02-12 11:45:55 has no hits.

BS15754.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:36:24 Download gff for BS15754.3prime
Subject Subject Range Query Range Percent Splice Strand
RpS27-PA 1..255 17..271 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:16:01 Download gff for BS15754.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10423-PA 1..255 17..271 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 23:20:24 Download gff for BS15754.3prime
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 75..333 15..273 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:58:51 Download gff for BS15754.3prime
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 75..333 15..273 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:58:51 Download gff for BS15754.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 25246351..25246381 15..45 93 <- Plus
3R 25246448..25246678 46..276 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 23:20:24 Download gff for BS15754.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21072170..21072400 46..276 98   Plus
arm_3R 21072073..21072103 15..45 93 <- Plus

BS15754.5prime Sequence

285 bp (285 high quality bases) assembled on 2006-12-21

> BS15754.5prime
GAAGTTATCAGTCGACATGCCGCTAGCAAAAGATCTTCTGCACCCTCTGC
CCGCCGAGGAGAAGCGCAAGCACAAGCTGAAGCGCCTGGTCCAGCACCCC
AACTCGTACTTCATGGACGTGAAGTGCCCCGGCTGCTACAGGATCACCAC
CGTCTTCAGCCACGCCCAAGGCGTCGTGGTCTGCGCTGGATGCGCTACCA
TTTTGTGCCAGCCGACTGGAGGACGCGCCAAGCTGACAGAAGGCTGCTCC
TTCCGCAGGAAGCCACAGTAAAAGCTTTCTAGACC

BS15754.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG10423-PA 255 RpS27-RA 1..255 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-05 23:53:39
Subject Length Description Subject Range Query Range Score Percent Strand
RpS27-RB 687 CG10423-RB 33..291 15..273 1295 100 Plus
RpS27-RA 729 CG10423-RA 75..333 15..273 1295 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-05 23:53:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25246447..25246672 243..18 1115 99.6 Minus
Blast to na_te.dros performed on 2015-02-05 23:53:35 has no hits.

BS15754.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:36:25 Download gff for BS15754.5prime
Subject Subject Range Query Range Percent Splice Strand
RpS27-PA 1..255 17..271 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:16:03 Download gff for BS15754.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10423-PA 1..255 17..271 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 03:33:10 Download gff for BS15754.5prime
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 75..333 15..273 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 00:33:45 Download gff for BS15754.5prime
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 75..333 15..273 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 00:33:45 Download gff for BS15754.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 25246351..25246381 243..273 100 <- Minus
3R 25246448..25246678 12..242 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 03:33:10 Download gff for BS15754.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21072073..21072103 243..273 100 <- Minus
arm_3R 21072170..21072400 12..242 98   Minus

BS15754.complete Sequence

287 bp assembled on 2006-11-29

GenBank Submission: FJ637959

> BS15754.complete
GAAGTTATCAGTCGACATGCCGCTAGCAAAAGATCTTCTGCACCCTCTGC
CCGCCGAGGAGAAGCGCAAGCACAAGCTGAAGCGCCTGGTCCAGCACCCC
AACTCGTACTTCATGGACGTGAAGTGCCCCGGCTGCTACAGGATCACCAC
CGTCTTCAGCCACGCCCAAGGCGTCGTGGTCTGCGCTGGATGCGCTACCA
TTTTGTGCCAGCCGACTGGAGGACGCGCCAAGCTGACAGAAGGCTGCTCC
TTCCGCAGGAAGCCACAGTAAAAGCTTTCTAGACCAT

BS15754.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
RpS27-RB 255 CG10423-PB 1..255 17..271 1275 100 Plus
RpS27-RA 255 CG10423-PA 1..255 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
RpS27-RB 687 CG10423-RB 33..291 15..273 1295 100 Plus
RpS27-RA 729 CG10423-RA 75..333 15..273 1295 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:35:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25246447..25246672 243..18 1115 99.6 Minus
Blast to na_te.dros performed on 2014-11-27 20:35:08 has no hits.

BS15754.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:32:07 Download gff for BS15754.complete
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 1..255 17..271 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:04:34 Download gff for BS15754.complete
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 61..319 15..273 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:09:19 Download gff for BS15754.complete
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 77..329 17..269 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:32:07 Download gff for BS15754.complete
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 61..319 15..273 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:24:17 Download gff for BS15754.complete
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 77..329 17..269 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:24:17 Download gff for BS15754.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25246448..25246672 17..242 99   Minus
3R 25246355..25246381 243..269 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:09:19 Download gff for BS15754.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21072077..21072103 243..269 100 <- Minus
arm_3R 21072170..21072394 17..242 99   Minus

BS15754.pep Sequence

Translation from 16 to 270

> BS15754.pep
MPLAKDLLHPLPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYRITTVFSHA
QGVVVCAGCATILCQPTGGRAKLTEGCSFRRKPQ*

BS15754.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
RpS27-PB 84 CG10423-PB 1..84 1..84 461 100 Plus
RpS27-PA 84 CG10423-PA 1..84 1..84 461 100 Plus