Clone Sequence Records
BS15754.3prime Sequence
285 bp (285 high quality bases) assembled on 2006-12-21
> BS15754.3prime
ATGGTCTAGAAAGCTTTTACCTTGGCTTCCTGCGGAAGGAGCAGCCTTCT
GTCAGCTTGGCGCGTCCTCCAGTCGGCTGGCACAAAATGGTAGCGCATCC
AGCGCAGACCACGACGCCTTGGGCGTGGCTGAAGACGGTGGTGATCCTGT
AGCAGCCGGGGCACTTCACGTCCATGAAGTACGAGTTGGGGTGCTGGACC
AGGCGCTTCAGCTTGTGCTTGCGCTTCTCCTCGGCGGGCAGAGGGTGCAG
AAGATCTTTTGCTAGCGGCATGTCGACTGATAACT
BS15754.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:27:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG10423-PA | 255 | RpS27-RA | 1..249 | 271..23 | 1245 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:46:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS27-RB | 687 | CG10423-RB | 33..291 | 273..15 | 1265 | 99.2 | Minus |
RpS27-RA | 729 | CG10423-RA | 75..333 | 273..15 | 1265 | 99.2 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:45:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 25246447..25246672 | 45..270 | 1115 | 99.6 | Plus |
Blast to na_te.dros performed on 2015-02-12 11:45:55 has no hits.
BS15754.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:36:24 Download gff for
BS15754.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS27-PA | 1..255 | 17..271 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:16:01 Download gff for
BS15754.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10423-PA | 1..255 | 17..271 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 23:20:24 Download gff for
BS15754.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS27-RA | 75..333 | 15..273 | 99 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:58:51 Download gff for
BS15754.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS27-RA | 75..333 | 15..273 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:58:51 Download gff for
BS15754.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 25246351..25246381 | 15..45 | 93 | <- | Plus |
3R | 25246448..25246678 | 46..276 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 23:20:24 Download gff for
BS15754.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 21072170..21072400 | 46..276 | 98 | | Plus |
arm_3R | 21072073..21072103 | 15..45 | 93 | <- | Plus |
BS15754.5prime Sequence
285 bp (285 high quality bases) assembled on 2006-12-21
> BS15754.5prime
GAAGTTATCAGTCGACATGCCGCTAGCAAAAGATCTTCTGCACCCTCTGC
CCGCCGAGGAGAAGCGCAAGCACAAGCTGAAGCGCCTGGTCCAGCACCCC
AACTCGTACTTCATGGACGTGAAGTGCCCCGGCTGCTACAGGATCACCAC
CGTCTTCAGCCACGCCCAAGGCGTCGTGGTCTGCGCTGGATGCGCTACCA
TTTTGTGCCAGCCGACTGGAGGACGCGCCAAGCTGACAGAAGGCTGCTCC
TTCCGCAGGAAGCCACAGTAAAAGCTTTCTAGACC
BS15754.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:27:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG10423-PA | 255 | RpS27-RA | 1..255 | 17..271 | 1275 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-05 23:53:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS27-RB | 687 | CG10423-RB | 33..291 | 15..273 | 1295 | 100 | Plus |
RpS27-RA | 729 | CG10423-RA | 75..333 | 15..273 | 1295 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-05 23:53:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 25246447..25246672 | 243..18 | 1115 | 99.6 | Minus |
Blast to na_te.dros performed on 2015-02-05 23:53:35 has no hits.
BS15754.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:36:25 Download gff for
BS15754.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS27-PA | 1..255 | 17..271 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:16:03 Download gff for
BS15754.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10423-PA | 1..255 | 17..271 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 03:33:10 Download gff for
BS15754.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS27-RA | 75..333 | 15..273 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 00:33:45 Download gff for
BS15754.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS27-RA | 75..333 | 15..273 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 00:33:45 Download gff for
BS15754.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 25246351..25246381 | 243..273 | 100 | <- | Minus |
3R | 25246448..25246678 | 12..242 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 03:33:10 Download gff for
BS15754.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 21072073..21072103 | 243..273 | 100 | <- | Minus |
arm_3R | 21072170..21072400 | 12..242 | 98 | | Minus |
BS15754.complete Sequence
287 bp assembled on 2006-11-29
GenBank Submission: FJ637959
> BS15754.complete
GAAGTTATCAGTCGACATGCCGCTAGCAAAAGATCTTCTGCACCCTCTGC
CCGCCGAGGAGAAGCGCAAGCACAAGCTGAAGCGCCTGGTCCAGCACCCC
AACTCGTACTTCATGGACGTGAAGTGCCCCGGCTGCTACAGGATCACCAC
CGTCTTCAGCCACGCCCAAGGCGTCGTGGTCTGCGCTGGATGCGCTACCA
TTTTGTGCCAGCCGACTGGAGGACGCGCCAAGCTGACAGAAGGCTGCTCC
TTCCGCAGGAAGCCACAGTAAAAGCTTTCTAGACCAT
BS15754.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:35:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS27-RB | 255 | CG10423-PB | 1..255 | 17..271 | 1275 | 100 | Plus |
RpS27-RA | 255 | CG10423-PA | 1..255 | 17..271 | 1275 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:35:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS27-RB | 687 | CG10423-RB | 33..291 | 15..273 | 1295 | 100 | Plus |
RpS27-RA | 729 | CG10423-RA | 75..333 | 15..273 | 1295 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:35:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 25246447..25246672 | 243..18 | 1115 | 99.6 | Minus |
Blast to na_te.dros performed on 2014-11-27 20:35:08 has no hits.
BS15754.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:32:07 Download gff for
BS15754.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS27-RA | 1..255 | 17..271 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 03:04:34 Download gff for
BS15754.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS27-RA | 61..319 | 15..273 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:09:19 Download gff for
BS15754.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS27-RA | 77..329 | 17..269 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:32:07 Download gff for
BS15754.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS27-RA | 61..319 | 15..273 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:24:17 Download gff for
BS15754.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS27-RA | 77..329 | 17..269 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:24:17 Download gff for
BS15754.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 25246448..25246672 | 17..242 | 99 | | Minus |
3R | 25246355..25246381 | 243..269 | 100 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:09:19 Download gff for
BS15754.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 21072077..21072103 | 243..269 | 100 | <- | Minus |
arm_3R | 21072170..21072394 | 17..242 | 99 | | Minus |
BS15754.pep Sequence
Translation from 16 to 270
> BS15754.pep
MPLAKDLLHPLPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYRITTVFSHA
QGVVVCAGCATILCQPTGGRAKLTEGCSFRRKPQ*
BS15754.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:23:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS27-PB | 84 | CG10423-PB | 1..84 | 1..84 | 461 | 100 | Plus |
RpS27-PA | 84 | CG10423-PA | 1..84 | 1..84 | 461 | 100 | Plus |