Clone BS15779 Report

Search the DGRC for BS15779

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:157
Well:79
Vector:pDNR-Dual
Associated Gene/TranscriptCG32388-RA
Protein status:BS15779.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS15779.3prime Sequence

270 bp (270 high quality bases) assembled on 2006-12-21

> BS15779.3prime
ATGGTCTAGAAAGCTTCTACCTTTTCTTGCACTCATCTTTGGATTTGTCT
GAGCCGCCGGGTTTGTTTTTGCAACGTGGTGAAGTGGGAACAACCTTTCT
GCCACACATATCCTTCTTCTTTTTGTCTTTCTTCTTTTTGGAATCGGCAC
CCTTGCAAGAATCCTTGCCCGAATCCTTCGGCGATTTGGCCATTAGTCGT
GCGCCGAAAACGCCTTCACTCAATTTCATGAGCGCCAAGCTGCGCACTTT
GAACATGTCGACTGATAACT

BS15779.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG32388-PA 240 CG32388-RA 1..235 256..22 1125 99.1 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-05 21:29:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG43439-RA 990 CG43439-RA 84..324 257..17 1160 98.8 Minus
CG32388-RA 990 CG32388-RA 84..324 257..17 1160 98.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-05 21:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6984343..6984503 97..257 805 100 Plus
3L 28110227 3L 6984200..6984277 17..94 375 98.7 Plus
Blast to na_te.dros performed 2015-02-05 21:29:36
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 1724..1786 123..61 108 63.5 Minus

BS15779.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:37:17 Download gff for BS15779.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32388-PA 1..240 17..256 98   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:17:05 Download gff for BS15779.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32388-PA 1..240 17..256 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 03:20:47 Download gff for BS15779.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 68..332 9..270 95   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 00:22:34 Download gff for BS15779.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 68..332 9..270 95   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 00:22:34 Download gff for BS15779.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 6984192..6984279 9..96 93 <- Plus
3L 6984343..6984518 97..270 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 03:20:47 Download gff for BS15779.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6977292..6977379 9..96 93 <- Plus
arm_3L 6977443..6977618 97..270 97   Plus

BS15779.5prime Sequence

270 bp (270 high quality bases) assembled on 2006-12-21

> BS15779.5prime
GAAGTTATCAGTCGACATGTTCAAAGTGCGCAGCTTGGCGCTCATGAAAT
TGAGTGAAGGCGTTTTCGGCGCACGACTAATGGCCAAATCGCCGAAGGAT
TCGGGCAAGGATTCTTGCAAGGGTGCCGATTCCAAAAAGAAGAAAGACAA
AAAGAAGAAGGATATGTGTGGCAGAACTGTTGTTCCCACTTCACCACGTT
GCAAAAACAAACCCGGCGGCTCAGACAAATCCAAAGATGAGTGCAAGAAA
AAGTAGAAGCTTTCTAGACC

BS15779.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 19:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG32388-PA 240 CG32388-RA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 12:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG43439-RA 990 CG43439-RA 84..324 16..256 1205 100 Plus
CG32388-RA 990 CG32388-RA 84..324 16..256 1205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 12:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6984343..6984503 176..16 805 100 Minus
3L 28110227 3L 6984200..6984279 256..177 400 100 Minus
Blast to na_te.dros performed 2015-01-30 12:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 1724..1786 150..212 99 61.9 Plus

BS15779.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 11:37:18 Download gff for BS15779.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32388-PA 1..240 17..256 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 13:17:07 Download gff for BS15779.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32388-PA 1..240 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-05 09:35:45 Download gff for BS15779.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 67..332 2..264 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 14:00:27 Download gff for BS15779.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 67..332 2..264 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 14:00:27 Download gff for BS15779.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 6984192..6984279 177..264 96 <- Minus
3L 6984343..6984519 2..176 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-05 09:35:45 Download gff for BS15779.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6977292..6977379 177..264 96 <- Minus
arm_3L 6977443..6977619 2..176 97   Minus

BS15779.complete Sequence

272 bp assembled on 2006-11-29

GenBank Submission: FJ637964

> BS15779.complete
GAAGTTATCAGTCGACATGTTCAAAGTGCGCAGCTTGGCGCTCATGAAAT
TGAGTGAAGGCGTTTTCGGCGCACGACTAATGGCCAAATCGCCGAAGGAT
TCGGGCAAGGATTCTTGCAAGGGTGCCGATTCCAAAAAGAAGAAAGACAA
AAAGAAGAAGGATATGTGTGGCAGAACTGTTGTTCCCACTTCACCACGTT
GCAAAAACAAACCCGGCGGCTCAGACAAATCCAAAGATGAGTGCAAGAAA
AAGTAGAAGCTTTCTAGACCAT

BS15779.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:47:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG32388-RA 240 CG32388-PA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:47:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG43439-RA 990 CG43439-RA 84..324 16..256 1205 100 Plus
CG32388-RA 990 CG32388-RA 84..324 16..256 1205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6984343..6984503 176..16 805 100 Minus
3L 28110227 3L 6984200..6984279 256..177 400 100 Minus
Blast to na_te.dros performed 2014-11-28 00:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 1724..1786 150..212 99 61.9 Plus

BS15779.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:44 Download gff for BS15779.complete
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 1..240 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:12:31 Download gff for BS15779.complete
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 53..318 2..264 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:59:41 Download gff for BS15779.complete
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 90..324 22..256 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:45 Download gff for BS15779.complete
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 53..318 2..264 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:26:38 Download gff for BS15779.complete
Subject Subject Range Query Range Percent Splice Strand
CG32388-RA 90..324 22..256 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:26:38 Download gff for BS15779.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6984200..6984279 177..256 100 <- Minus
3L 6984343..6984497 22..176 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:59:41 Download gff for BS15779.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6977300..6977379 177..256 100 <- Minus
arm_3L 6977443..6977597 22..176 100   Minus

BS15779.pep Sequence

Translation from 16 to 255

> BS15779.pep
MFKVRSLALMKLSEGVFGARLMAKSPKDSGKDSCKGADSKKKKDKKKKDM
CGRTVVPTSPRCKNKPGGSDKSKDECKKK*

BS15779.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:48:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG32388-PA 79 CG32388-PA 1..79 1..79 415 100 Plus