Clone BS15840 Report

Search the DGRC for BS15840

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:158
Well:40
Vector:pDNR-Dual
Associated Gene/Transcriptave-RA
Protein status:BS15840.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS15840.3prime Sequence

351 bp (351 high quality bases) assembled on 2007-04-16

> BS15840.3prime
ATGGTCTAGAAAGCTTCTAGCAAATATTGAGCCTTTCCATATCCCGGATT
TCCATGATATCCGTCTTCAGTCGCTGCTTAACGATCTCCCGCCAAATGGC
TTCCCGATCCCGGTTGTCCGTCACGCCCATTCTTTGCAGTGAGGAGTCTG
TGATCCGGAGTAGAGCCCTTCCGGTTATATCGTGCTGGGCGAAGAGCTGC
TCATACTGGGTGTATTCACCGCAGTGGCGGCGATACCACTTGAGCACATC
GCTAACTGTCCACAGGTACACTGCCTTCGGTCGCGTAGTTTTCGTTCTGG
TTTTGTTTTGCGTTGAGTTAATAGTTTCTTCACCCATGTCGACTGATAAC
T

BS15840.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG30476-PA 321 CG30476-RA 1..316 337..22 1580 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
ave-RA 546 CG30476-RA 70..390 337..17 1590 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14752943..14753113 187..17 840 99.4 Minus
2R 25286936 2R 14752590..14752742 337..185 765 100 Minus
Blast to na_te.dros performed on 2015-02-12 17:11:35 has no hits.

BS15840.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:59:29 Download gff for BS15840.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30476-PA 1..321 17..337 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 17:11:19 Download gff for BS15840.3prime
Subject Subject Range Query Range Percent Splice Strand
ave-RA 58..390 17..350 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:26:18 Download gff for BS15840.3prime
Subject Subject Range Query Range Percent Splice Strand
ave-RA 58..390 17..350 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:26:18 Download gff for BS15840.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 14752578..14752742 185..350 96 -> Minus
2R 14752946..14753113 17..184 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 17:11:19 Download gff for BS15840.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10640083..10640247 185..350 96 -> Minus
arm_2R 10640451..10640618 17..184 99   Minus

BS15840.5prime Sequence

351 bp (351 high quality bases) assembled on 2007-04-17

> BS15840.5prime
GAAGTTATCACTCGACATGGGTGAAGAAACTATTAACTCAACGCAAAACA
AAACCAGAACGAAAACTACGCGACCGAAGGCAGTGTACCTGTGGACAGTT
AGCGATGTGCTCAAGTGGTATCGCCGCCACTGCGGTGAATACACCCAGTA
TGAGCAGCTCTTCGCCCAGCACGATATAACCGGAAGGGCTCTACTCCGGA
TCACAGACTCCTCACTGCAAAGAATGGGCGTGACGGACAACCGGGATCGG
GAAGCCATTTGGCGGGAGATCGTTAAGCAGCGACTGAAGACGGATATCAT
GGAAATCCGGGATATGGAAAGGCTCAATATTTACTAGAAGCTTTCTAGAC
C

BS15840.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 01:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG30476-PA 321 CG30476-RA 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:02:57
Subject Length Description Subject Range Query Range Score Percent Strand
ave-RA 546 CG30476-RA 70..390 17..337 1605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14752943..14753113 167..337 855 100 Plus
2R 25286936 2R 14752590..14752742 17..169 765 100 Plus
Blast to na_te.dros performed on 2015-02-13 16:02:56 has no hits.

BS15840.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:59:30 Download gff for BS15840.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30476-PA 1..321 17..337 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 12:56:11 Download gff for BS15840.5prime
Subject Subject Range Query Range Percent Splice Strand
ave-RA 67..390 14..337 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:43:14 Download gff for BS15840.5prime
Subject Subject Range Query Range Percent Splice Strand
ave-RA 67..390 14..337 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:43:14 Download gff for BS15840.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 14752587..14752742 14..169 99 -> Plus
2R 14752946..14753113 170..337 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 12:56:11 Download gff for BS15840.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10640092..10640247 14..169 99 -> Plus
arm_2R 10640451..10640618 170..337 100   Plus

BS15840.complete Sequence

353 bp assembled on 2007-05-07

GenBank Submission: FJ637974

> BS15840.complete
GAAGTTATCAGTCGACATGGGTGAAGAAACTATTAACTCAACGCAAAACA
AAACCAGAACGAAAACTACGCGACCGAAGGCAGTGTACCTGTGGACAGTT
AGCGATGTGCTCAAGTGGTATCGCCGCCACTGCGGTGAATACACCCAGTA
TGAGCAGCTCTTCGCCCAGCACGATATAACCGGAAGGGCTCTACTCCGGA
TCACAGACTCCTCACTGCAAAGAATGGGCGTGACGGACAACCGGGATCGG
GAAGCCATTTGGCGGGAGATCGTTAAGCAGCGACTGAAGACGGATATCAT
GGAAATCCGGGATATGGAAAGGCTCAATATTTACTAGAAGCTTTCTAGAC
CAT

BS15840.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:39:02
Subject Length Description Subject Range Query Range Score Percent Strand
ave-RA 321 CG30476-PA 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
ave-RA 546 CG30476-RA 70..390 17..337 1605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:39:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14752943..14753113 167..337 855 100 Plus
2R 25286936 2R 14752590..14752742 17..169 765 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:39:01 has no hits.

BS15840.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:44:04 Download gff for BS15840.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 1..321 17..337 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:31:10 Download gff for BS15840.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 53..385 4..337 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:44:10 Download gff for BS15840.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 70..390 17..337 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:44:04 Download gff for BS15840.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 53..385 4..337 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:12:56 Download gff for BS15840.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 70..390 17..337 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:12:56 Download gff for BS15840.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14752590..14752742 17..169 100 -> Plus
2R 14752946..14753113 170..337 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:44:10 Download gff for BS15840.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10640095..10640247 17..169 100 -> Plus
arm_2R 10640451..10640618 170..337 100   Plus

BS15840.pep Sequence

Translation from 16 to 336

> BS15840.pep
MGEETINSTQNKTRTKTTRPKAVYLWTVSDVLKWYRRHCGEYTQYEQLFA
QHDITGRALLRITDSSLQRMGVTDNRDREAIWREIVKQRLKTDIMEIRDM
ERLNIY*

BS15840.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
ave-PA 106 CG30476-PA 1..106 1..106 557 100 Plus