Clone BS15978 Report

Search the DGRC for BS15978

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:159
Well:78
Vector:pDNR-Dual
Associated Gene/Transcriptfabp-RA
Protein status:BS15978.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS15978.3prime Sequence

384 bp (384 high quality bases) assembled on 2007-04-16

> BS15978.3prime
ATGGTCTAGAAAGCTTTTAGACGGCCTTGTAGACGCGCACGCACTTAACG
TTGCCGATGGTGAGGGTGGTGATCAGCTCGTTGTCGGTGAACTCGCGGAC
GATGGTGGTGGGCTTGTCGCCCTTCTGCTCCTGCGTCAGCTTGTTGCCAT
CCAGGGTGATGATGCTCTTGACGTTGCGACCGTCCAGGGTCTCCTCGTCG
AACTCAACGCCCAGCTTGAAGCTGATGGCAGAGGTCTTGAAGGTGGAGGT
GGTAGTCAGGGTGTAGGTATCGCCCTCCAAGGTCACCTCCACTGTGGGGC
TCAGGCTGTTGCCCATCTTGCGCGTCACCAGACCGACGCCGAAAGATGAA
TGATGGGGCAGACTGCACATGTCGACTGATAACT

BS15978.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:16:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG6783-PA 354 CG6783-RA 1..354 370..17 1770 100 Minus
CG6783-PB 393 CG6783-RB 70..393 340..17 1620 100 Minus
CG6783-PC 474 CG6783-RC 70..342 340..68 1365 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:01:35
Subject Length Description Subject Range Query Range Score Percent Strand
fabp-RA 1051 CG6783-RA 435..788 370..17 1770 100 Minus
fabp-RB 723 CG6783-RB 137..460 340..17 1620 100 Minus
fabp-RC 1660 CG6783-RC 137..409 340..68 1365 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11564440..11564712 68..340 1365 100 Plus
3R 32079331 3R 11564321..11564371 17..67 255 100 Plus
Blast to na_te.dros performed on 2015-02-11 23:01:31 has no hits.

BS15978.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:00:57 Download gff for BS15978.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6783-PA 1..354 17..370 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 04:43:47 Download gff for BS15978.3prime
Subject Subject Range Query Range Percent Splice Strand
fabp-RA 424..795 7..375 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:33:35 Download gff for BS15978.3prime
Subject Subject Range Query Range Percent Splice Strand
fabp-RA 429..800 7..375 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:33:35 Download gff for BS15978.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 11564309..11564371 7..67 93 <- Plus
3R 11564440..11564711 68..339 100 <- Plus
3R 11564784..11564820 340..375 91   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 04:43:47 Download gff for BS15978.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7390031..7390093 7..67 93 <- Plus
arm_3R 7390162..7390433 68..339 100 <- Plus
arm_3R 7390506..7390542 340..375 91   Plus

BS15978.5prime Sequence

384 bp (384 high quality bases) assembled on 2007-04-16

> BS15978.5prime
GAAGTTATCAGTCGACATGTGCAGTCTGCCCCATCATTCATCTTTCGGCG
TCGGTCTGGTGACGCGCAAGATGGGCAACAGCCTGAGCCCCACAGTGGAG
GTGACCTTGGAGGGCGATACCTACACCCTGACTACCACCTCCACCTTCAA
GACCTCTGCCATCAGCTTCAAGCTGGGCGTTGAGTTCGACGAGGAGACCC
TGGACGGTCGCAACGTCAAGAGCATCATCACCCTGGATGGCAACAAGCTG
ACGCAGGAGCAGAAGGGCGACAAGCCCACCACCATCGTCCGCGAGTTCAC
CGACAACGAGCTGATCACCACCCTCACCATCGGCAACGTTAAGTGCGTGC
GCGTCTACAAGGCCGTCTAAAAGCTTTCTAGACC

BS15978.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG6783-PA 354 CG6783-RA 1..354 17..370 1770 100 Plus
CG6783-PB 393 CG6783-RB 70..393 47..370 1620 100 Plus
CG6783-PC 474 CG6783-RC 70..342 47..319 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
fabp-RA 1051 CG6783-RA 435..788 17..370 1770 100 Plus
fabp-RB 723 CG6783-RB 137..460 47..370 1620 100 Plus
fabp-RC 1660 CG6783-RC 137..409 47..319 1365 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:01:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11564440..11564712 319..47 1365 100 Minus
3R 32079331 3R 11564321..11564371 370..320 255 100 Minus
Blast to na_te.dros performed on 2015-02-11 23:01:43 has no hits.

BS15978.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:00:57 Download gff for BS15978.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6783-PA 1..354 17..370 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 04:43:50 Download gff for BS15978.5prime
Subject Subject Range Query Range Percent Splice Strand
fabp-RA 424..795 12..380 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:33:53 Download gff for BS15978.5prime
Subject Subject Range Query Range Percent Splice Strand
fabp-RA 429..800 12..380 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:33:53 Download gff for BS15978.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 11564309..11564371 320..380 93 <- Minus
3R 11564440..11564711 48..319 100 <- Minus
3R 11564784..11564820 12..47 91   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 04:43:50 Download gff for BS15978.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7390031..7390093 320..380 93 <- Minus
arm_3R 7390162..7390433 48..319 100 <- Minus
arm_3R 7390506..7390542 12..47 91   Minus

BS15978.complete Sequence

386 bp assembled on 2007-05-07

GenBank Submission: FJ638007

> BS15978.complete
GAAGTTATCAGTCGACATGTGCAGTCTGCCCCATCATTCATCTTTCGGCG
TCGGTCTGGTGACGCGCAAGATGGGCAACAGCCTGAGCCCCACAGTGGAG
GTGACCTTGGAGGGCGATACCTACACCCTGACTACCACCTCCACCTTCAA
GACCTCTGCCATCAGCTTCAAGCTGGGCGTTGAGTTCGACGAGGAGACCC
TGGACGGTCGCAACGTCAAGAGCATCATCACCCTGGATGGCAACAAGCTG
ACGCAGGAGCAGAAGGGCGACAAGCCCACCACCATCGTCCGCGAGTTCAC
CGACAACGAGCTGATCACCACCCTCACCATCGGCAACGTTAAGTGCGTGC
GCGTCTACAAGGCCGTCTAAAAGCTTTCTAGACCAT

BS15978.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
fabp-RA 354 CG6783-PA 1..354 17..370 1770 100 Plus
fabp-RB 393 CG6783-PB 70..393 47..370 1620 100 Plus
fabp-RC 474 CG6783-PC 70..342 47..319 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
fabp-RA 1051 CG6783-RA 435..788 17..370 1770 100 Plus
fabp-RB 723 CG6783-RB 137..460 47..370 1620 100 Plus
fabp-RC 1660 CG6783-RC 137..409 47..319 1365 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:15:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11564440..11564712 319..47 1365 100 Minus
3R 32079331 3R 11564321..11564371 370..320 255 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:15:27 has no hits.

BS15978.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:45:50 Download gff for BS15978.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RA 1..354 17..370 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:33:17 Download gff for BS15978.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RA 424..795 12..380 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:52:01 Download gff for BS15978.complete
Subject Subject Range Query Range Percent Splice Strand
fabp-RA 430..781 17..368 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:45:50 Download gff for BS15978.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RA 424..795 12..380 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:55:42 Download gff for BS15978.complete
Subject Subject Range Query Range Percent Splice Strand
fabp-RA 435..786 17..368 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:55:42 Download gff for BS15978.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11564323..11564371 320..368 100 <- Minus
3R 11564440..11564711 48..319 100 <- Minus
3R 11564784..11564814 17..47 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:52:01 Download gff for BS15978.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7390162..7390433 48..319 100 <- Minus
arm_3R 7390506..7390536 17..47 100   Minus
arm_3R 7390045..7390093 320..368 100 <- Minus

BS15978.pep Sequence

Translation from 16 to 369

> BS15978.pep
MCSLPHHSSFGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAIS
FKLGVEFDEETLDGRNVKSIITLDGNKLTQEQKGDKPTTIVREFTDNELI
TTLTIGNVKCVRVYKAV*

BS15978.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
fabp-PA 117 CG6783-PA 1..117 1..117 595 100 Plus
fabp-PB 130 CG6783-PB 24..130 11..117 536 100 Plus
fabp-PC 157 CG6783-PC 24..116 11..103 456 97.8 Plus