Clone Sequence Records
BS16003.5prime Sequence
285 bp (285 high quality bases) assembled on 2007-04-16
> BS16003.5prime
GAAGTTATCAGTCGACATGGTCAGTTTTGAGGAAGCCGCCGAACTCGCCA
AGAACTTCTCCAAGAAGCCCACCGACTCCGAGTTCCTGGAGTTCTACGGT
CTCTTCAAGCAGGCTACCGTTGGTGATGTGAACATCGACAAGCCCGGCAT
TCTGGATCTCAAGAAGAAGGCCATGTACGAGGCCTGGAACGCCCACAAGG
GTCTCTCCAAGGATGCCGCCAAGGAGGCCTACGTGAAGGTGTACGAGAAG
TATGCCCCCAAGTACGCCTAAAAGCTTTCTAGACC
BS16003.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:20:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8629-PA | 255 | CG8629-RA | 1..255 | 17..271 | 1275 | 100 | Plus |
CG8628-PA | 255 | CG8628-RA | 13..255 | 29..271 | 565 | 89.3 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:13:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8629-RA | 352 | CG8629-RA | 36..290 | 17..271 | 1275 | 100 | Plus |
CG8628-RA | 429 | CG8628-RA | 71..313 | 29..271 | 825 | 89.3 | Plus |
CG8628-RB | 408 | CG8628-RB | 50..292 | 29..271 | 825 | 89.3 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:13:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 7127975..7128229 | 271..17 | 1275 | 100 | Minus |
3L | 28110227 | 3L | 7131147..7131389 | 29..271 | 825 | 89.3 | Plus |
Blast to na_te.dros performed on 2015-02-12 10:13:43 has no hits.
BS16003.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:08 Download gff for
BS16003.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8629-PA | 1..255 | 17..271 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 21:44:05 Download gff for
BS16003.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8629-RA | 36..293 | 17..275 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:55:13 Download gff for
BS16003.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8629-RA | 36..293 | 17..275 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 12:55:13 Download gff for
BS16003.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7127972..7128229 | 17..275 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 21:44:05 Download gff for
BS16003.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 7121072..7121329 | 17..275 | 99 | | Minus |
BS16003.3prime Sequence
285 bp (285 high quality bases) assembled on 2007-04-16
> BS16003.3prime
ATGGTCTAGAAAGCTTTTAGGCGTACTTGGGGGCATACTTCTCGTACACC
TTCACGTAGGCCTCCTTGGCGGCATCCTTGGAGAGACCCTTGTGGGCGTT
CCAGGCCTCGTACATGGCCTTCTTCTTGAGATCCAGAATGCCGGGCTTGT
CGATGTTCACATCACCAACGGTAGCCTGCTTGAAGAGACCGTAGAACTCC
AGGAACTCGGAGTCGGTGGGCTTCTTGGAGAAGTTCTTGGCGAGTTCGGC
GGCTTCCTCAAAACTGACCATGTCGACTGATAACT
BS16003.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:19:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8629-PA | 255 | CG8629-RA | 1..255 | 271..17 | 1275 | 100 | Minus |
CG8628-PA | 255 | CG8628-RA | 13..255 | 259..17 | 565 | 89.3 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:25:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8629-RA | 352 | CG8629-RA | 36..290 | 271..17 | 1275 | 100 | Minus |
CG8628-RA | 429 | CG8628-RA | 71..313 | 259..17 | 825 | 89.3 | Minus |
CG8628-RB | 408 | CG8628-RB | 50..292 | 259..17 | 825 | 89.3 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:25:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 7127975..7128229 | 17..271 | 1275 | 100 | Plus |
3L | 28110227 | 3L | 7131147..7131389 | 259..17 | 825 | 89.3 | Minus |
Blast to na_te.dros performed on 2015-02-13 06:25:27 has no hits.
BS16003.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:07 Download gff for
BS16003.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8629-PA | 1..255 | 17..271 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 19:49:05 Download gff for
BS16003.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8629-RA | 36..293 | 13..271 | 99 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:33:28 Download gff for
BS16003.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8629-RA | 36..293 | 13..271 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 08:33:28 Download gff for
BS16003.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7127972..7128229 | 13..271 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 19:49:05 Download gff for
BS16003.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 7121072..7121329 | 13..271 | 99 | | Plus |
BS16003.complete Sequence
287 bp assembled on 2007-05-07
GenBank Submission: FJ638016
> BS16003.complete
GAAGTTATCAGTCGACATGGTCAGTTTTGAGGAAGCCGCCGAACTCGCCA
AGAACTTCTCCAAGAAGCCCACCGACTCCGAGTTCCTGGAGTTCTACGGT
CTCTTCAAGCAGGCTACCGTTGGTGATGTGAACATCGACAAGCCCGGCAT
TCTGGATCTCAAGAAGAAGGCCATGTACGAGGCCTGGAACGCCCACAAGG
GTCTCTCCAAGGATGCCGCCAAGGAGGCCTACGTGAAGGTGTACGAGAAG
TATGCCCCCAAGTACGCCTAAAAGCTTTCTAGACCAT
BS16003.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:58:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8629-RA | 255 | CG8629-PA | 1..255 | 17..271 | 1275 | 100 | Plus |
CG8628-RA | 255 | CG8628-PA | 13..255 | 29..271 | 825 | 89.3 | Plus |
CG8628-RB | 255 | CG8628-PB | 13..255 | 29..271 | 825 | 89.3 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:58:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8629-RA | 352 | CG8629-RA | 36..290 | 17..271 | 1275 | 100 | Plus |
CG8628-RA | 429 | CG8628-RA | 71..313 | 29..271 | 825 | 89.3 | Plus |
CG8628-RB | 408 | CG8628-RB | 50..292 | 29..271 | 825 | 89.3 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:58:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 7127975..7128229 | 271..17 | 1275 | 100 | Minus |
3L | 28110227 | 3L | 7131147..7131389 | 29..271 | 825 | 89.3 | Plus |
Blast to na_te.dros performed on 2014-11-26 21:58:08 has no hits.
BS16003.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:43:37 Download gff for
BS16003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8629-RA | 1..255 | 17..271 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:30:38 Download gff for
BS16003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8629-RA | 32..289 | 17..275 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:42:22 Download gff for
BS16003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8629-RA | 36..288 | 17..269 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:43:37 Download gff for
BS16003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8629-RA | 32..289 | 17..275 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:47:16 Download gff for
BS16003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8629-RA | 36..288 | 17..269 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:47:16 Download gff for
BS16003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7127977..7128229 | 17..269 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:42:22 Download gff for
BS16003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 7121077..7121329 | 17..269 | 100 | | Minus |
BS16003.pep Sequence
Translation from 16 to 270
> BS16003.pep
MVSFEEAAELAKNFSKKPTDSEFLEFYGLFKQATVGDVNIDKPGILDLKK
KAMYEAWNAHKGLSKDAAKEAYVKVYEKYAPKYA*
BS16003.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:54:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8629-PA | 84 | CG8629-PA | 1..84 | 1..84 | 435 | 100 | Plus |
CG8628-PA | 84 | CG8628-PA | 1..84 | 1..84 | 366 | 83.3 | Plus |
CG8628-PB | 84 | CG8628-PB | 1..84 | 1..84 | 366 | 83.3 | Plus |
CG15829-PB | 82 | CG15829-PB | 1..81 | 1..83 | 240 | 56.6 | Plus |
CG15829-PA | 82 | CG15829-PA | 1..81 | 1..83 | 240 | 56.6 | Plus |