Clone BS16008 Report

Search the DGRC for BS16008

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:8
Vector:pDNR-Dual
Associated Gene/Transcriptssp7-RA
Protein status:BS16008.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16008.5prime Sequence

297 bp (297 high quality bases) assembled on 2007-04-16

> BS16008.5prime
GAAGTTATCAGTCGACATGAAATCGGTCACGTTCGTACTCTGCCTGCTCG
TTCTGGGCGCCCACTCGCTGCTGGTGTTCGCCGTGGATTGCGAGATCGGT
GGGCATCAGTTCAAGACCGGAGAGAAGTACACGCCGGAAGGTCGCTGCCT
GCAGTACACCTGCCAGGCACCCAAACAGGTGACTGCCTTGGGATGCCCGG
CCATCGCCTCCTTGAAGCCCTGCAAAATGGAAGAGGATCTGAGCAAACCC
TATCCCGGCTGCTGTCCCAAGTTCAACTGCTGAAAGCTTTCTAGACC

BS16008.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG32667-PA 267 CG32667-RA 1..267 17..283 1335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
ssp7-RA 368 CG32667-RA 20..286 17..283 1335 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11140001..11140110 192..83 550 100 Minus
X 23542271 X 11139844..11139935 283..192 460 100 Minus
X 23542271 X 11140178..11140244 83..17 335 100 Minus
Blast to na_te.dros performed on 2015-02-12 05:03:04 has no hits.

BS16008.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:11 Download gff for BS16008.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32667-PA 1..267 17..283 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 07:19:56 Download gff for BS16008.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 14..286 9..283 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:31:29 Download gff for BS16008.5prime
Subject Subject Range Query Range Percent Splice Strand
ssp7-RA 14..286 9..283 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:31:29 Download gff for BS16008.5prime
Subject Subject Range Query Range Percent Splice Strand
X 11139844..11139934 193..283 100 <- Minus
X 11140001..11140109 84..192 100 <- Minus
X 11140178..11140250 9..83 94   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 07:19:56 Download gff for BS16008.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 11033877..11033967 193..283 100 <- Minus
arm_X 11034034..11034142 84..192 100 <- Minus
arm_X 11034211..11034283 9..83 94   Minus

BS16008.3prime Sequence

297 bp (297 high quality bases) assembled on 2007-04-16

> BS16008.3prime
ATGGTCTAGAAAGCTTTCAGCAGTTGAACTTGGGACAGCAGCCGGGATAG
GGTTTGCTCAGATCCTCTTCCATTTTGCAGGGCTTCAAGGAGGCGATGGC
CGGGCATCCCAAGGCAGTCACCTGTTTGGGTGCCTGGCAGGTGTACTGCA
GGCAGCGACCTTCCGGCGTGTACTTCTCTCCGGTCTTGAACTGATGCCCA
CCGATCTCGCAATCCACGGCGAACACCAGCAGCGAGTGGGCGCCCAGAAC
GAGCAGGCAGAGTACGAACGTGACCGATTTCATGTCGACTGATAACT

BS16008.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG32667-PA 267 CG32667-RA 1..267 283..17 1335 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:13:47
Subject Length Description Subject Range Query Range Score Percent Strand
ssp7-RA 368 CG32667-RA 20..286 283..17 1335 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11140001..11140110 108..217 550 100 Plus
X 23542271 X 11139844..11139935 17..108 460 100 Plus
X 23542271 X 11140178..11140244 217..283 335 100 Plus
Blast to na_te.dros performed on 2015-02-12 10:13:46 has no hits.

BS16008.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:10 Download gff for BS16008.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32667-PA 1..267 17..283 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 21:44:07 Download gff for BS16008.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 14..286 17..291 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:55:19 Download gff for BS16008.3prime
Subject Subject Range Query Range Percent Splice Strand
ssp7-RA 14..286 17..291 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 12:55:19 Download gff for BS16008.3prime
Subject Subject Range Query Range Percent Splice Strand
X 11140001..11140109 108..216 100 <- Plus
X 11140178..11140250 217..291 94   Plus
X 11139844..11139934 17..107 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 21:44:07 Download gff for BS16008.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 11033877..11033967 17..107 100 <- Plus
arm_X 11034034..11034142 108..216 100 <- Plus
arm_X 11034211..11034283 217..291 94   Plus

BS16008.complete Sequence

299 bp assembled on 2007-05-07

GenBank Submission: FJ638019

> BS16008.complete
GAAGTTATCAGTCGACATGAAATCGGTCACGTTCGTACTCTGCCTGCTCG
TTCTGGGCGCCCACTCGCTGCTGGTGTTCGCCGTGGATTGCGAGATCGGT
GGGCATCAGTTCAAGACCGGAGAGAAGTACACGCCGGAAGGTCGCTGCCT
GCAGTACACCTGCCAGGCACCCAAACAGGTGACTGCCTTGGGATGCCCGG
CCATCGCCTCCTTGAAGCCCTGCAAAATGGAAGAGGATCTGAGCAAACCC
TATCCCGGCTGCTGTCCCAAGTTCAACTGCTGAAAGCTTTCTAGACCAT

BS16008.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:55:37
Subject Length Description Subject Range Query Range Score Percent Strand
ssp7-RA 267 CG32667-PA 1..267 17..283 1335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
ssp7-RA 368 CG32667-RA 20..286 17..283 1335 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11140001..11140110 192..83 550 100 Minus
X 23542271 X 11139844..11139935 283..192 460 100 Minus
X 23542271 X 11140178..11140244 83..17 335 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:55:35 has no hits.

BS16008.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:45:55 Download gff for BS16008.complete
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 1..267 17..283 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:33:22 Download gff for BS16008.complete
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 14..286 9..283 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:05:07 Download gff for BS16008.complete
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 20..285 17..282 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:45:55 Download gff for BS16008.complete
Subject Subject Range Query Range Percent Splice Strand
CG32667-RA 14..286 9..283 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:34:25 Download gff for BS16008.complete
Subject Subject Range Query Range Percent Splice Strand
ssp7-RA 20..285 17..282 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:34:25 Download gff for BS16008.complete
Subject Subject Range Query Range Percent Splice Strand
X 11139845..11139934 193..282 100 <- Minus
X 11140001..11140109 84..192 100 <- Minus
X 11140178..11140244 17..83 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:05:07 Download gff for BS16008.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11033878..11033967 193..282 100 <- Minus
arm_X 11034034..11034142 84..192 100 <- Minus
arm_X 11034211..11034277 17..83 100   Minus

BS16008.pep Sequence

Translation from 16 to 282

> BS16008.pep
MKSVTFVLCLLVLGAHSLLVFAVDCEIGGHQFKTGEKYTPEGRCLQYTCQ
APKQVTALGCPAIASLKPCKMEEDLSKPYPGCCPKFNC*

BS16008.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
ssp7-PA 88 CG32667-PA 1..88 1..88 488 100 Plus