Clone BS16009 Report

Search the DGRC for BS16009

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:9
Vector:pDNR-Dual
Associated Gene/TranscriptCG13751-RA
Protein status:BS16009.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16009.5prime Sequence

264 bp (264 high quality bases) assembled on 2007-04-16

> BS16009.5prime
GAAGTTATCAGTCGACATGCCTGTTTTGGAGCACATCAAAGCCATGGCAG
AGACTCCGACTCCAGCTGAGAACAGCCCTGCACCGGCAGACGAGAATGCT
CCGCCCCAGGCAGTCCGGGAACTGACGCAGACCGACCATCTCAACCGACG
CCTTCTCAAATCGCTCCTGGAAAACATGCAGGCCACCGAGGTTCTGGCGC
AGGAGAACGGGAACGGCTCCAACGAGGAGGACAACGATTTCGAAGAATAA
AAGCTTTCTAGACC

BS16009.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:21:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG13751-PA 234 CG13751-RA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13751-RA 377 CG13751-RA 102..336 17..251 1175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8900342..8900576 17..251 1175 100 Plus
Blast to na_te.dros performed on 2015-02-13 16:09:17 has no hits.

BS16009.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:11 Download gff for BS16009.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13751-PA 1..234 17..250 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 12:57:22 Download gff for BS16009.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 102..344 17..260 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:35:22 Download gff for BS16009.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 102..344 17..260 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:35:22 Download gff for BS16009.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 8900342..8900584 17..260 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 12:57:22 Download gff for BS16009.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4787847..4788089 17..260 98   Plus

BS16009.3prime Sequence

264 bp (264 high quality bases) assembled on 2007-04-16

> BS16009.3prime
ATGGTCTAGAAAGCTTTTATTCTTCGAAATCGTTGTCCTCCTCGTTGGAG
CCGTTCCCGTTCTCCTGCGCCAGAACCTCGGTGGCCTGCATGTTTTCCAG
GAGCGATTTGAGAAGGCGTCGGTTGAGATGGTCGGTCTGCGTCAGTTCCC
GGACTGCCTGGGGCGGAGCATTCTCGTCTGCCGGTGCAGGGCTGTTCTCA
GCTGGAGTCGGAGTCTCTGCCATGGCTTTGATGTGCTCCAAAACAGGCAT
GTCGACTGATAACT

BS16009.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:21:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG13751-PA 234 CG13751-RA 1..234 250..17 1170 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:39:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13751-RA 377 CG13751-RA 102..336 250..16 1175 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8900342..8900576 250..16 1175 100 Minus
Blast to na_te.dros performed on 2015-02-13 01:39:51 has no hits.

BS16009.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:11 Download gff for BS16009.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13751-PA 1..234 17..250 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 00:13:24 Download gff for BS16009.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 102..344 7..250 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:21:43 Download gff for BS16009.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 102..344 7..250 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:21:43 Download gff for BS16009.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 8900342..8900584 7..250 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 00:13:24 Download gff for BS16009.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4787847..4788089 7..250 98   Minus

BS16009.complete Sequence

266 bp assembled on 2007-05-07

GenBank Submission: FJ638020

> BS16009.complete
GAAGTTATCAGTCGACATGCCTGTTTTGGAGCACATCAAAGCCATGGCAG
AGACTCCGACTCCAGCTGAGAACAGCCCTGCACCGGCAGACGAGAATGCT
CCGCCCCAGGCAGTCCGGGAACTGACGCAGACCGACCATCTCAACCGACG
CCTTCTCAAATCGCTCCTGGAAAACATGCAGGCCACCGAGGTTCTGGCGC
AGGAGAACGGGAACGGCTCCAACGAGGAGGACAACGATTTCGAAGAATAA
AAGCTTTCTAGACCAT

BS16009.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:55:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13751-RA 234 CG13751-PA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:55:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG13751-RA 377 CG13751-RA 102..336 17..251 1175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:55:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8900342..8900576 17..251 1175 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:55:26 has no hits.

BS16009.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:50:21 Download gff for BS16009.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 1..234 17..250 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:38:59 Download gff for BS16009.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 102..344 17..260 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:34:22 Download gff for BS16009.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 102..327 17..242 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:50:21 Download gff for BS16009.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 102..344 17..260 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:40:32 Download gff for BS16009.complete
Subject Subject Range Query Range Percent Splice Strand
CG13751-RA 102..327 17..242 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:40:32 Download gff for BS16009.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8900342..8900567 17..242 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:34:22 Download gff for BS16009.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4787847..4788072 17..242 100   Plus

BS16009.pep Sequence

Translation from 16 to 249

> BS16009.pep
MPVLEHIKAMAETPTPAENSPAPADENAPPQAVRELTQTDHLNRRLLKSL
LENMQATEVLAQENGNGSNEEDNDFEE*

BS16009.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG13751-PA 77 CG13751-PA 1..77 1..77 396 100 Plus