Clone Sequence Records
BS16009.5prime Sequence
264 bp (264 high quality bases) assembled on 2007-04-16
> BS16009.5prime
GAAGTTATCAGTCGACATGCCTGTTTTGGAGCACATCAAAGCCATGGCAG
AGACTCCGACTCCAGCTGAGAACAGCCCTGCACCGGCAGACGAGAATGCT
CCGCCCCAGGCAGTCCGGGAACTGACGCAGACCGACCATCTCAACCGACG
CCTTCTCAAATCGCTCCTGGAAAACATGCAGGCCACCGAGGTTCTGGCGC
AGGAGAACGGGAACGGCTCCAACGAGGAGGACAACGATTTCGAAGAATAA
AAGCTTTCTAGACC
BS16009.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:21:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13751-PA | 234 | CG13751-RA | 1..234 | 17..250 | 1170 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:09:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13751-RA | 377 | CG13751-RA | 102..336 | 17..251 | 1175 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:09:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8900342..8900576 | 17..251 | 1175 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-13 16:09:17 has no hits.
BS16009.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:11 Download gff for
BS16009.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13751-PA | 1..234 | 17..250 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 12:57:22 Download gff for
BS16009.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13751-RA | 102..344 | 17..260 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:35:22 Download gff for
BS16009.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13751-RA | 102..344 | 17..260 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:35:22 Download gff for
BS16009.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8900342..8900584 | 17..260 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 12:57:22 Download gff for
BS16009.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4787847..4788089 | 17..260 | 98 | | Plus |
BS16009.3prime Sequence
264 bp (264 high quality bases) assembled on 2007-04-16
> BS16009.3prime
ATGGTCTAGAAAGCTTTTATTCTTCGAAATCGTTGTCCTCCTCGTTGGAG
CCGTTCCCGTTCTCCTGCGCCAGAACCTCGGTGGCCTGCATGTTTTCCAG
GAGCGATTTGAGAAGGCGTCGGTTGAGATGGTCGGTCTGCGTCAGTTCCC
GGACTGCCTGGGGCGGAGCATTCTCGTCTGCCGGTGCAGGGCTGTTCTCA
GCTGGAGTCGGAGTCTCTGCCATGGCTTTGATGTGCTCCAAAACAGGCAT
GTCGACTGATAACT
BS16009.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:21:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13751-PA | 234 | CG13751-RA | 1..234 | 250..17 | 1170 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:39:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13751-RA | 377 | CG13751-RA | 102..336 | 250..16 | 1175 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:39:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8900342..8900576 | 250..16 | 1175 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-13 01:39:51 has no hits.
BS16009.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:11 Download gff for
BS16009.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13751-PA | 1..234 | 17..250 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 00:13:24 Download gff for
BS16009.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13751-RA | 102..344 | 7..250 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:21:43 Download gff for
BS16009.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13751-RA | 102..344 | 7..250 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:21:43 Download gff for
BS16009.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8900342..8900584 | 7..250 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 00:13:24 Download gff for
BS16009.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4787847..4788089 | 7..250 | 98 | | Minus |
BS16009.complete Sequence
266 bp assembled on 2007-05-07
GenBank Submission: FJ638020
> BS16009.complete
GAAGTTATCAGTCGACATGCCTGTTTTGGAGCACATCAAAGCCATGGCAG
AGACTCCGACTCCAGCTGAGAACAGCCCTGCACCGGCAGACGAGAATGCT
CCGCCCCAGGCAGTCCGGGAACTGACGCAGACCGACCATCTCAACCGACG
CCTTCTCAAATCGCTCCTGGAAAACATGCAGGCCACCGAGGTTCTGGCGC
AGGAGAACGGGAACGGCTCCAACGAGGAGGACAACGATTTCGAAGAATAA
AAGCTTTCTAGACCAT
BS16009.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:55:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13751-RA | 234 | CG13751-PA | 1..234 | 17..250 | 1170 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:55:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13751-RA | 377 | CG13751-RA | 102..336 | 17..251 | 1175 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:55:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8900342..8900576 | 17..251 | 1175 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 00:55:26 has no hits.
BS16009.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:50:21 Download gff for
BS16009.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13751-RA | 1..234 | 17..250 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:38:59 Download gff for
BS16009.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13751-RA | 102..344 | 17..260 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:34:22 Download gff for
BS16009.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13751-RA | 102..327 | 17..242 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:50:21 Download gff for
BS16009.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13751-RA | 102..344 | 17..260 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:40:32 Download gff for
BS16009.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13751-RA | 102..327 | 17..242 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:40:32 Download gff for
BS16009.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8900342..8900567 | 17..242 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:34:22 Download gff for
BS16009.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4787847..4788072 | 17..242 | 100 | | Plus |
BS16009.pep Sequence
Translation from 16 to 249
> BS16009.pep
MPVLEHIKAMAETPTPAENSPAPADENAPPQAVRELTQTDHLNRRLLKSL
LENMQATEVLAQENGNGSNEEDNDFEE*
BS16009.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:46:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13751-PA | 77 | CG13751-PA | 1..77 | 1..77 | 396 | 100 | Plus |