Clone BS16013 Report

Search the DGRC for BS16013

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:13
Vector:pDNR-Dual
Associated Gene/TranscriptCG4440-RA
Protein status:BS16013.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16013.3prime Sequence

270 bp (270 high quality bases) assembled on 2007-04-16

> BS16013.3prime
ATGGTCTAGAAAGCTTTTACCTTTAAAAACCGCCGAAACCACCAAACTCT
TGTTGCTGCTGACCAAAGTTTCCATTTCCGCCAAAACTTTCCTGCTGTTG
CTGCTGTCCAAAGGAACCGAAACCACCGAATCCTTGTCCAAAACCGCCCT
GCTGTTGCTGCTGCTCAAGCCCGCCACCAAATCCGCCGAATCCGAACTGG
GGACGCGCCGAGGCTATGGCAAACAGAGCAATCAGACAGAAAATCAAGAA
TTTCATGTCGACTGATAACT

BS16013.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:22:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG4440-PA 240 CG4440-RA 1..233 256..24 1165 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG4440-RB 538 CG4440-RB 84..316 256..24 1165 100 Minus
CG4440-RA 384 CG4440-RA 84..316 256..24 1165 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 19:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16330078..16330299 245..24 1110 100 Minus
Blast to na_te.dros performed on 2015-02-11 19:09:31 has no hits.

BS16013.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:14 Download gff for BS16013.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4440-PA 1..240 16..256 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-27 05:11:44 Download gff for BS16013.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 79..324 15..261 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:05:42 Download gff for BS16013.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 79..324 15..261 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 00:05:42 Download gff for BS16013.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 16330074..16330301 23..250 98 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-27 05:11:44 Download gff for BS16013.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16330074..16330301 23..250 98 -> Minus

BS16013.5prime Sequence

270 bp (270 high quality bases) assembled on 2007-04-16

> BS16013.5prime
GAAGTTATCCTTCGACATGAAATTCTTGATTTTCTGTCTGATTGCTCTGT
TTGCCATAGCCTCGGCGCGTCCCCAGTTCGGATTCGGCGGATTTGGTGGC
GGGCTTGAGCAGCAGCAACAGCAGGGCGGTTTTGGACAAGGATTCGGTGG
TTTCGGTTCCTTTGGACAGCAGCAACAGCAGGAAAGTTTTGGCGGAAATG
GAAACTTTGGTCAGCAGCAACAAGAGTTTGGTGGTTTCGGCGGTTTTTAC
GGTTAAAAGCTTTCTAGACC

BS16013.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG4440-PA 240 CG4440-RA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:58:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG4440-RB 538 CG4440-RB 84..324 17..257 1205 100 Plus
CG4440-RA 384 CG4440-RA 84..324 17..257 1205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:58:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16330078..16330307 28..257 1150 100 Plus
Blast to na_te.dros performed on 2015-02-11 15:58:19 has no hits.

BS16013.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:15 Download gff for BS16013.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4440-PA 1..240 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 20:24:24 Download gff for BS16013.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 78..328 11..261 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:30:51 Download gff for BS16013.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 78..328 11..261 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:30:51 Download gff for BS16013.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 16330074..16330311 23..261 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 20:24:24 Download gff for BS16013.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16330074..16330311 23..261 98   Plus

BS16013.complete Sequence

272 bp assembled on 2007-05-07

GenBank Submission: FJ638022

> BS16013.complete
GAAGTTATCAGTCGACATGAAATTCTTGATTTTCTGTCTGATTGCTCTGT
TTGCCATAGCCTCGGCGCGTCCCCAGTTCGGATTCGGCGGATTTGGTGGC
GGGCTTGAGCAGCAGCAACAGCAGGGCGGTTTTGGACAAGGATTCGGTGG
TTTCGGTTCCTTTGGACAGCAGCAACAGCAGGAAAGTTTTGGCGGAAATG
GAAACTTTGGTCAGCAGCAACAAGAGTTTGGTGGTTTCGGCGGTTTTTAC
GGTTAAAAGCTTTCTAGACCAT

BS16013.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG4440-RB 240 CG4440-PB 1..240 17..256 1200 100 Plus
CG4440-RA 240 CG4440-PA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG4440-RB 538 CG4440-RB 84..324 17..257 1205 100 Plus
CG4440-RA 384 CG4440-RA 84..324 17..257 1205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16330078..16330307 28..257 1150 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:58:39 has no hits.

BS16013.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:46:00 Download gff for BS16013.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 1..240 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:33:25 Download gff for BS16013.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 77..326 12..261 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:43:36 Download gff for BS16013.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 84..321 17..254 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:46:00 Download gff for BS16013.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 77..326 12..261 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:35:41 Download gff for BS16013.complete
Subject Subject Range Query Range Percent Splice Strand
CG4440-RA 84..321 17..254 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:35:41 Download gff for BS16013.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16330074..16330304 23..254 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:43:36 Download gff for BS16013.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16330074..16330304 23..254 99   Plus

BS16013.pep Sequence

Translation from 16 to 255

> BS16013.pep
MKFLIFCLIALFAIASARPQFGFGGFGGGLEQQQQQGGFGQGFGGFGSFG
QQQQQESFGGNGNFGQQQQEFGGFGGFYG*

BS16013.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG4440-PB 79 CG4440-PB 1..79 1..79 429 100 Plus
CG4440-PA 79 CG4440-PA 1..79 1..79 429 100 Plus
CG15282-PB 79 CG15282-PB 1..78 1..74 228 66.7 Plus
CG15282-PC 79 CG15282-PC 1..78 1..74 228 66.7 Plus
CG15282-PA 79 CG15282-PA 1..78 1..74 228 66.7 Plus