Clone BS16015 Report

Search the DGRC for BS16015

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptCecC-RA
Protein status:BS16015.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16015.complete Sequence

224 bp assembled on 2007-05-07

GenBank Submission: FJ638023

> BS16015.complete
GAAGTTATCAGTCGACATGAACTTCTACAAGATCTTCGTTTTCGTCGCCC
TCATCCTGGCCATCAGCATTGGACAATCGGAAGCCGGTTGGCTGAAGAAA
CTTGGCAAGAGAATCGAGCGCATTGGCCAGCACACCCGGGATGCAACCAT
TCAAGGACTGGGAATTGCGCAACAGGCCGCCAATGTGGCAGCCACCGCCA
GAGGATGAAAGCTTTCTAGACCAT

BS16015.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
CecC-RA 192 CG1373-PA 1..192 17..208 960 100 Plus
CecA1-RA 192 CG1365-PA 1..192 17..208 585 87 Plus
CecA2-RA 192 CG1367-PA 1..179 17..195 565 87.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
CecC-RA 386 CG1373-RA 93..285 16..208 965 100 Plus
CecA1-RA 339 CG1365-RA 74..266 16..208 590 87 Plus
CecA2-RA 355 CG1367-RA 82..261 16..195 570 87.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30216576..30216676 16..116 505 100 Plus
3R 32079331 3R 30216745..30216837 116..208 465 100 Plus
3R 32079331 3R 30210947..30211047 16..116 385 92.1 Plus
3R 32079331 3R 30212237..30212337 16..116 385 92.1 Plus
3R 32079331 3R 30213626..30213730 116..12 225 81 Minus
3R 32079331 3R 30211111..30211200 119..208 210 82.2 Plus
3R 32079331 3R 30213474..30213565 210..119 205 81.5 Minus
3R 32079331 3R 30212402..30212474 123..195 200 84.9 Plus
Blast to na_te.dros performed on 2014-11-27 16:18:47 has no hits.

BS16015.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:50:19 Download gff for BS16015.complete
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 1..192 17..208 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:05:28 Download gff for BS16015.complete
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 89..292 12..218 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:52:12 Download gff for BS16015.complete
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 94..284 17..207 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:50:20 Download gff for BS16015.complete
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 89..292 12..218 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:15:41 Download gff for BS16015.complete
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 94..284 17..207 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:15:41 Download gff for BS16015.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30216577..30216675 17..115 100 -> Plus
3R 30216745..30216836 116..207 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:52:12 Download gff for BS16015.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26042467..26042558 116..207 100   Plus
arm_3R 26042299..26042397 17..115 100 -> Plus

BS16015.3prime Sequence

222 bp (222 high quality bases) assembled on 2007-04-16

> BS16015.3prime
ATGGTCTAGAAAGCTTTCATCCTCTGGCGGTGGCTGCCACATTGGCGGCC
TGTTGCGCAATTCCCAGTCCTTGAATGGTTGCATCCCGGGTGTGCTGGCC
AATGCGCTCGATTCTCTTGCCAAGTTTCTTCAGCCAACCGGCTTCCGATT
GTCCAATGCTGATGGCCAGGATGAGGGCGACGAAAACGAAGATCTTGTAG
AAGTTCATGTCGACTGATAACT

BS16015.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG1373-PA 192 CecC-RA 1..192 208..17 960 100 Minus
CG1365-PA 192 CecA1-RA 1..170 208..39 375 88.8 Minus
CG1367-PA 192 CecA2-RA 1..101 208..108 305 92 Minus
CG1367-PA 192 CecA2-RA 139..179 70..30 130 92.6 Minus
CG1878-PA 192 CecB-RA 1..51 208..158 130 90.1 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:38:38
Subject Length Description Subject Range Query Range Score Percent Strand
CecC-RA 386 CG1373-RA 93..285 209..17 965 100 Minus
CecA1-RA 339 CG1365-RA 74..266 209..17 590 87 Minus
CecA2-RA 355 CG1367-RA 82..261 209..30 570 87.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30216576..30216676 209..109 505 100 Minus
3R 32079331 3R 30216745..30216837 109..17 465 100 Minus
3R 32079331 3R 30210947..30211047 209..109 385 92.1 Minus
3R 32079331 3R 30212237..30212337 209..109 385 92.1 Minus
3R 32079331 3R 30213626..30213730 109..213 225 81 Plus
3R 32079331 3R 30211111..30211200 106..17 210 82.2 Minus
3R 32079331 3R 30213474..30213565 15..106 205 81.5 Plus
3R 32079331 3R 30212402..30212474 102..30 200 84.9 Minus
Blast to na_te.dros performed on 2015-02-11 04:38:36 has no hits.

BS16015.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:16 Download gff for BS16015.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1373-PA 1..192 17..208 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 09:11:19 Download gff for BS16015.3prime
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 89..292 7..213 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 06:54:48 Download gff for BS16015.3prime
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 89..292 7..213 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 06:54:48 Download gff for BS16015.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 30216745..30216844 7..109 96   Minus
3R 30216572..30216675 110..213 98 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 09:11:19 Download gff for BS16015.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26042294..26042397 110..213 98 -> Minus
arm_3R 26042467..26042566 7..109 96   Minus

BS16015.5prime Sequence

222 bp (222 high quality bases) assembled on 2007-04-16

> BS16015.5prime
GAAGTTATCAGTCGACATGAACTTCTACAAGATCTTCGTTTTCGTCGCCC
TCATCCTGGCCATCAGCATTGGACAATCGGAAGCCGGTTGGCTGAAGAAA
CTTGGCAAGAGAATCGAGCGCATTGGCCAGCACACCCGGGATGCAACCAT
TCAAGGACTGGGAATTGCGCAACAGGCCGCCAATGTGGCAGCCACCGCCA
GAGGATGAAAGCTTTCTAGACC

BS16015.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG1373-PA 192 CecC-RA 1..192 17..208 960 100 Plus
CG1365-PA 192 CecA1-RA 1..170 17..186 375 88.8 Plus
CG1367-PA 192 CecA2-RA 1..101 17..117 305 92 Plus
CG1367-PA 192 CecA2-RA 139..179 155..195 130 92.6 Plus
CG1878-PA 192 CecB-RA 1..51 17..67 130 90.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
CecC-RA 386 CG1373-RA 93..285 16..208 965 100 Plus
CecA1-RA 339 CG1365-RA 74..266 16..208 590 87 Plus
CecA2-RA 355 CG1367-RA 82..261 16..195 570 87.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30216576..30216676 16..116 505 100 Plus
3R 32079331 3R 30216745..30216837 116..208 465 100 Plus
3R 32079331 3R 30210947..30211047 16..116 385 92.1 Plus
3R 32079331 3R 30212237..30212337 16..116 385 92.1 Plus
3R 32079331 3R 30213626..30213730 116..12 225 81 Minus
3R 32079331 3R 30211111..30211200 119..208 210 82.2 Plus
3R 32079331 3R 30213474..30213565 210..119 205 81.5 Minus
3R 32079331 3R 30212402..30212474 123..195 200 84.9 Plus
Blast to na_te.dros performed on 2015-02-13 06:25:47 has no hits.

BS16015.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:16 Download gff for BS16015.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1373-PA 1..192 17..208 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 19:49:14 Download gff for BS16015.5prime
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 89..292 12..218 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:34:03 Download gff for BS16015.5prime
Subject Subject Range Query Range Percent Splice Strand
CecC-RA 89..292 12..218 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 08:34:03 Download gff for BS16015.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 30216572..30216675 12..115 98 -> Plus
3R 30216745..30216844 116..218 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 19:49:14 Download gff for BS16015.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26042467..26042566 116..218 96   Plus
arm_3R 26042294..26042397 12..115 98 -> Plus

BS16015.pep Sequence

Translation from 16 to 207

> BS16015.pep
MNFYKIFVFVALILAISIGQSEAGWLKKLGKRIERIGQHTRDATIQGLGI
AQQAANVAATARG*

BS16015.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
CecC-PA 63 CG1373-PA 1..63 1..63 311 100 Plus
CecA2-PA 63 CG1367-PA 1..63 1..63 297 92.1 Plus
CecA1-PA 63 CG1365-PA 1..63 1..63 297 92.1 Plus
CecB-PA 63 CG1878-PA 1..63 1..63 276 88.9 Plus