Clone BS16017 Report

Search the DGRC for BS16017

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:17
Vector:pDNR-Dual
Associated Gene/TranscriptCG6610-RA
Protein status:BS16017.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16017.3prime Sequence

306 bp (306 high quality bases) assembled on 2007-04-16

> BS16017.3prime
ATGGTCTAGAAAGCTTCTACTCCGCCAGCTCTCCGCCAGGCACCAACATT
GTGATATTGTTCCCGTTGAGCAGAATCTGATCCAGTTTGGTGATGCGGCG
GCCGTCGGGGGTATTTTCATACTCCGTTACGTCGTCCAAGAGCATATTCA
CAAAGTCATCGAATCCTAAGAGAGTTCCCACCATCTCCTTGTCGTTCTTC
ATGATAATGTGGATGCGGGAACCGATGCATTTGTCCACCAATTCCAATGG
CATTAGGGTAGAGATGTTGGAGGGGGGTGGAACGGCAGTCATGTCGACTG
ATAACT

BS16017.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG6610-PA 276 CG6610-RA 1..276 292..17 1380 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:53:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG6610-RC 520 CG6610-RC 103..380 294..17 1390 100 Minus
CG6610-RB 421 CG6610-RB 103..380 294..17 1390 100 Minus
CG6610-RA 586 CG6610-RA 103..380 294..17 1390 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6075760..6075961 244..43 995 99.5 Minus
3L 28110227 3L 6075638..6075688 294..244 255 100 Minus
Blast to na_te.dros performed on 2015-02-10 15:53:01 has no hits.

BS16017.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:17 Download gff for BS16017.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6610-PA 1..276 17..292 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 07:43:15 Download gff for BS16017.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 96..387 11..303 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:16:56 Download gff for BS16017.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 96..387 11..303 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:16:56 Download gff for BS16017.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 6075631..6075688 244..303 93 -> Minus
3L 6075761..6075957 47..243 100 -> Minus
3L 6076023..6076059 11..46 94   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 07:43:15 Download gff for BS16017.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6068731..6068788 244..303 93 -> Minus
arm_3L 6068861..6069057 47..243 100 -> Minus
arm_3L 6069123..6069159 11..46 94   Minus

BS16017.5prime Sequence

306 bp (306 high quality bases) assembled on 2007-04-16

> BS16017.5prime
GAAGTTATCAGTCGACATGACTGCCGTTCCACCCCCCTCCAACATCTCTA
CCCTAATGCCATTGGAATTGGTGGACAAATGCATCGGTTCCCGCATCCAC
ATTATCATGAAGAACGACAAGGAGATGGTGGGAACTCTCTTAGGATTCGA
TGACTTTGTGAATATGCTCTTGGACGACGTAACGGAGTATGAAAATACCC
CCGACGGCCGCCGCATCACCAAACTGGATCAGATTCTGCTCAACGGGAAC
AATATCACAATGTTGGTGCCTGGCGGAGAGCTGGCGGAGTAGAAGCTTTC
TAGACC

BS16017.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG6610-PA 276 CG6610-RA 1..276 17..292 1380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG6610-RC 520 CG6610-RC 103..380 15..292 1390 100 Plus
CG6610-RB 421 CG6610-RB 103..380 15..292 1390 100 Plus
CG6610-RA 586 CG6610-RA 103..380 15..292 1390 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6075760..6075961 65..266 995 99.5 Plus
3L 28110227 3L 6075638..6075688 15..65 255 100 Plus
Blast to na_te.dros performed on 2015-02-13 16:09:25 has no hits.

BS16017.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:17 Download gff for BS16017.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6610-PA 1..276 17..292 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 12:57:25 Download gff for BS16017.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 96..387 6..298 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:35:49 Download gff for BS16017.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 96..387 6..298 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:35:49 Download gff for BS16017.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 6075631..6075688 6..65 93 -> Plus
3L 6075761..6075957 66..262 100 -> Plus
3L 6076023..6076059 263..298 94   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 12:57:25 Download gff for BS16017.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6068731..6068788 6..65 93 -> Plus
arm_3L 6068861..6069057 66..262 100 -> Plus
arm_3L 6069123..6069159 263..298 94   Plus

BS16017.complete Sequence

308 bp assembled on 2007-05-07

GenBank Submission: FJ638024

> BS16017.complete
GAAGTTATCAGTCGACATGACTGCCGTTCCACCCCCCTCCAACATCTCTA
CCCTAATGCCATTGGAATTGGTGGACAAATGCATCGGTTCCCGCATCCAC
ATTATCATGAAGAACGACAAGGAGATGGTGGGAACTCTCTTAGGATTCGA
TGACTTTGTGAATATGCTCTTGGACGACGTAACGGAGTATGAAAATACCC
CCGACGGCCGCCGCATCACCAAACTGGATCAGATTCTGCTCAACGGGAAC
AATATCACAATGTTGGTGCCTGGCGGAGAGCTGGCGGAGTAGAAGCTTTC
TAGACCAT

BS16017.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:21:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG6610-RC 276 CG6610-PC 1..276 17..292 1380 100 Plus
CG6610-RB 276 CG6610-PB 1..276 17..292 1380 100 Plus
CG6610-RA 276 CG6610-PA 1..276 17..292 1380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:21:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG6610-RC 520 CG6610-RC 103..380 15..292 1390 100 Plus
CG6610-RB 421 CG6610-RB 103..380 15..292 1390 100 Plus
CG6610-RA 586 CG6610-RA 103..380 15..292 1390 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6075760..6075961 65..266 995 99.5 Plus
3L 28110227 3L 6075638..6075688 15..65 255 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:21:45 has no hits.

BS16017.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:50:18 Download gff for BS16017.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 1..276 17..292 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:38:58 Download gff for BS16017.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 95..386 6..298 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:29:10 Download gff for BS16017.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 105..380 17..292 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:50:18 Download gff for BS16017.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 95..386 6..298 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:16:43 Download gff for BS16017.complete
Subject Subject Range Query Range Percent Splice Strand
CG6610-RA 105..380 17..292 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:16:43 Download gff for BS16017.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6075640..6075688 17..65 100 -> Plus
3L 6075761..6075957 66..262 100 -> Plus
3L 6076023..6076052 263..292 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:29:10 Download gff for BS16017.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6068740..6068788 17..65 100 -> Plus
arm_3L 6068861..6069057 66..262 100 -> Plus
arm_3L 6069123..6069152 263..292 100   Plus

BS16017.pep Sequence

Translation from 16 to 291

> BS16017.pep
MTAVPPPSNISTLMPLELVDKCIGSRIHIIMKNDKEMVGTLLGFDDFVNM
LLDDVTEYENTPDGRRITKLDQILLNGNNITMLVPGGELAE*

BS16017.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG6610-PC 91 CG6610-PC 1..91 1..91 469 100 Plus
CG6610-PB 91 CG6610-PB 1..91 1..91 469 100 Plus
CG6610-PA 91 CG6610-PA 1..91 1..91 469 100 Plus