Clone BS16019 Report

Search the DGRC for BS16019

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:19
Vector:pDNR-Dual
Associated Gene/TranscriptNeb-cGP-RA
Protein status:BS16019.pep: full length peptide match
Sequenced Size:179

Clone Sequence Records

BS16019.3prime Sequence

177 bp (177 high quality bases) assembled on 2007-04-16

> BS16019.3prime
ATGGTCTAGAAAGCTTCTACTTCTTCTTGGGCTTCAGCACCTGGTAGGCG
ATCAGCAGGCCCATCACGGCGTACGTGGCCTTGGCCACATTTGCACGGCC
GCTCATGGTGGTGCCATTGAAGATTTTCGACAGGCCGGTCAGTTTCTCGC
CTTCGCCAGCCATGTCGACTGATAACT

BS16019.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG15304-PA 147 Neb-cGP-RA 1..147 163..17 735 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
Neb-cGP-RB 987 CG15304-RB 116..263 163..16 740 100 Minus
Neb-cGP-RA 410 CG15304-RA 116..263 163..16 740 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10460922..10460999 163..86 390 100 Minus
X 23542271 X 10461082..10461154 88..16 365 100 Minus
Blast to na_te.dros performed on 2015-02-11 23:06:49 has no hits.

BS16019.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:17 Download gff for BS16019.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15304-PA 1..147 17..163 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 04:44:10 Download gff for BS16019.3prime
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 116..263 16..163 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:30:20 Download gff for BS16019.3prime
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 116..263 16..163 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:30:20 Download gff for BS16019.3prime
Subject Subject Range Query Range Percent Splice Strand
X 10460914..10460996 89..172 95 -> Minus
X 10461082..10461154 16..88 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 04:44:10 Download gff for BS16019.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 10354947..10355029 89..172 95 -> Minus
arm_X 10355115..10355187 16..88 100   Minus

BS16019.5prime Sequence

177 bp (177 high quality bases) assembled on 2007-04-16

> BS16019.5prime
GAAGTTATCAGTCGACATGGCTGGCGAAGGCGAGAAACTGACCGGCCTGT
CGAAAATCTTCAATGGCACCACCATGAGCGGCCGTGCAAATGTGGCCAAG
GCCACGTACGCCGTGATGGGCCTGCTGATCGCCTACCAGGTGCTGAAGCC
CAAGAAGAAGTAGAAGCTTTCTAGACC

BS16019.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG15304-PA 147 Neb-cGP-RA 1..147 17..163 735 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
Neb-cGP-RB 987 CG15304-RB 116..263 17..164 740 100 Plus
Neb-cGP-RA 410 CG15304-RA 116..263 17..164 740 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10460922..10460999 17..94 390 100 Plus
X 23542271 X 10461082..10461154 92..164 365 100 Plus
Blast to na_te.dros performed on 2015-02-13 16:09:46 has no hits.

BS16019.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:18 Download gff for BS16019.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15304-PA 1..147 17..163 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 12:57:29 Download gff for BS16019.5prime
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 116..263 17..164 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:37:00 Download gff for BS16019.5prime
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 116..263 17..164 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:37:00 Download gff for BS16019.5prime
Subject Subject Range Query Range Percent Splice Strand
X 10460914..10460996 8..91 95 -> Plus
X 10461082..10461154 92..164 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 12:57:29 Download gff for BS16019.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 10354947..10355029 8..91 95 -> Plus
arm_X 10355115..10355187 92..164 100   Plus

BS16019.complete Sequence

179 bp assembled on 2010-02-09

GenBank Submission: KX805444

> BS16019.complete
GAAGTTATCAGTCGACATGGCTGGCGAAGGCGAGAAACTGACCGGCCTGT
CGAAAATCTTCAATGGCACCACCATGAGCGGCCGTGCAAATGTGGCCAAG
GCCACGTACGCCGTGATGGGCCTGCTGATCGCCTACCAGGTGCTGAAGCC
CAAGAAGAAGTAGAAGCTTTCTAGACCAT

BS16019.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:24:45
Subject Length Description Subject Range Query Range Score Percent Strand
Neb-cGP-RB 147 CG15304-PB 1..147 17..163 735 100 Plus
Neb-cGP-RA 147 CG15304-PA 1..147 17..163 735 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
Neb-cGP-RB 987 CG15304-RB 116..263 17..164 740 100 Plus
Neb-cGP-RA 410 CG15304-RA 116..263 17..164 740 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10460922..10460999 17..94 390 100 Plus
X 23542271 X 10461082..10461154 92..164 365 100 Plus
Blast to na_te.dros performed on 2014-11-28 04:24:44 has no hits.

BS16019.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:17:51 Download gff for BS16019.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 1..147 17..163 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:10:05 Download gff for BS16019.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 108..254 17..163 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:58:47 Download gff for BS16019.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 116..262 17..163 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:17:52 Download gff for BS16019.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 108..255 17..164 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:28:08 Download gff for BS16019.complete
Subject Subject Range Query Range Percent Splice Strand
Neb-cGP-RA 116..262 17..163 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:28:08 Download gff for BS16019.complete
Subject Subject Range Query Range Percent Splice Strand
X 10460922..10460996 17..91 100 -> Plus
X 10461082..10461153 92..163 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:58:47 Download gff for BS16019.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10354955..10355029 17..91 100 -> Plus
arm_X 10355115..10355186 92..163 100   Plus

BS16019.pep Sequence

Translation from 16 to 162

> BS16019.pep
MAGEGEKLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKKK*

BS16019.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
Neb-cGP-PB 48 CG15304-PB 1..48 1..48 237 100 Plus
Neb-cGP-PA 48 CG15304-PA 1..48 1..48 237 100 Plus