Clone Sequence Records
BS16019.3prime Sequence
177 bp (177 high quality bases) assembled on 2007-04-16
> BS16019.3prime
ATGGTCTAGAAAGCTTCTACTTCTTCTTGGGCTTCAGCACCTGGTAGGCG
ATCAGCAGGCCCATCACGGCGTACGTGGCCTTGGCCACATTTGCACGGCC
GCTCATGGTGGTGCCATTGAAGATTTTCGACAGGCCGGTCAGTTTCTCGC
CTTCGCCAGCCATGTCGACTGATAACT
BS16019.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:23:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15304-PA | 147 | Neb-cGP-RA | 1..147 | 163..17 | 735 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:06:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Neb-cGP-RB | 987 | CG15304-RB | 116..263 | 163..16 | 740 | 100 | Minus |
Neb-cGP-RA | 410 | CG15304-RA | 116..263 | 163..16 | 740 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:06:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 10460922..10460999 | 163..86 | 390 | 100 | Minus |
X | 23542271 | X | 10461082..10461154 | 88..16 | 365 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-11 23:06:49 has no hits.
BS16019.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:17 Download gff for
BS16019.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15304-PA | 1..147 | 17..163 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 04:44:10 Download gff for
BS16019.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 116..263 | 16..163 | 100 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:30:20 Download gff for
BS16019.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 116..263 | 16..163 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:30:20 Download gff for
BS16019.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 10460914..10460996 | 89..172 | 95 | -> | Minus |
X | 10461082..10461154 | 16..88 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 04:44:10 Download gff for
BS16019.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 10354947..10355029 | 89..172 | 95 | -> | Minus |
arm_X | 10355115..10355187 | 16..88 | 100 | | Minus |
BS16019.5prime Sequence
177 bp (177 high quality bases) assembled on 2007-04-16
> BS16019.5prime
GAAGTTATCAGTCGACATGGCTGGCGAAGGCGAGAAACTGACCGGCCTGT
CGAAAATCTTCAATGGCACCACCATGAGCGGCCGTGCAAATGTGGCCAAG
GCCACGTACGCCGTGATGGGCCTGCTGATCGCCTACCAGGTGCTGAAGCC
CAAGAAGAAGTAGAAGCTTTCTAGACC
BS16019.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:23:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15304-PA | 147 | Neb-cGP-RA | 1..147 | 17..163 | 735 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:09:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Neb-cGP-RB | 987 | CG15304-RB | 116..263 | 17..164 | 740 | 100 | Plus |
Neb-cGP-RA | 410 | CG15304-RA | 116..263 | 17..164 | 740 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:09:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 10460922..10460999 | 17..94 | 390 | 100 | Plus |
X | 23542271 | X | 10461082..10461154 | 92..164 | 365 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-13 16:09:46 has no hits.
BS16019.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:18 Download gff for
BS16019.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15304-PA | 1..147 | 17..163 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 12:57:29 Download gff for
BS16019.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 116..263 | 17..164 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:37:00 Download gff for
BS16019.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 116..263 | 17..164 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:37:00 Download gff for
BS16019.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 10460914..10460996 | 8..91 | 95 | -> | Plus |
X | 10461082..10461154 | 92..164 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 12:57:29 Download gff for
BS16019.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 10354947..10355029 | 8..91 | 95 | -> | Plus |
arm_X | 10355115..10355187 | 92..164 | 100 | | Plus |
BS16019.complete Sequence
179 bp assembled on 2010-02-09
GenBank Submission: KX805444
> BS16019.complete
GAAGTTATCAGTCGACATGGCTGGCGAAGGCGAGAAACTGACCGGCCTGT
CGAAAATCTTCAATGGCACCACCATGAGCGGCCGTGCAAATGTGGCCAAG
GCCACGTACGCCGTGATGGGCCTGCTGATCGCCTACCAGGTGCTGAAGCC
CAAGAAGAAGTAGAAGCTTTCTAGACCAT
BS16019.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:24:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Neb-cGP-RB | 147 | CG15304-PB | 1..147 | 17..163 | 735 | 100 | Plus |
Neb-cGP-RA | 147 | CG15304-PA | 1..147 | 17..163 | 735 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:24:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Neb-cGP-RB | 987 | CG15304-RB | 116..263 | 17..164 | 740 | 100 | Plus |
Neb-cGP-RA | 410 | CG15304-RA | 116..263 | 17..164 | 740 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:24:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 10460922..10460999 | 17..94 | 390 | 100 | Plus |
X | 23542271 | X | 10461082..10461154 | 92..164 | 365 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 04:24:44 has no hits.
BS16019.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 23:17:51 Download gff for
BS16019.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 1..147 | 17..163 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:10:05 Download gff for
BS16019.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 108..254 | 17..163 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:58:47 Download gff for
BS16019.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 116..262 | 17..163 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 23:17:52 Download gff for
BS16019.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 108..255 | 17..164 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:28:08 Download gff for
BS16019.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Neb-cGP-RA | 116..262 | 17..163 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:28:08 Download gff for
BS16019.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 10460922..10460996 | 17..91 | 100 | -> | Plus |
X | 10461082..10461153 | 92..163 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:58:47 Download gff for
BS16019.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 10354955..10355029 | 17..91 | 100 | -> | Plus |
arm_X | 10355115..10355186 | 92..163 | 100 | | Plus |
BS16019.pep Sequence
Translation from 16 to 162
> BS16019.pep
MAGEGEKLTGLSKIFNGTTMSGRANVAKATYAVMGLLIAYQVLKPKKK*
BS16019.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:16:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Neb-cGP-PB | 48 | CG15304-PB | 1..48 | 1..48 | 237 | 100 | Plus |
Neb-cGP-PA | 48 | CG15304-PA | 1..48 | 1..48 | 237 | 100 | Plus |