Clone Sequence Records
BS16023.3prime Sequence
264 bp (264 high quality bases) assembled on 2007-04-16
> BS16023.3prime
ATGGTCTAGAAAGCTTCTAGTCATCCTCGTCGTTGCGCACCTTCAGGGCG
CGCGGATCGTCGTGGCGGTAGACAACGTAGCCGAGCTTGTAGCGTCGGTT
ATCGCCGTCCTTGGCATAGTAGTTGGCCACTCCGATGGTGGCCATAACGA
TTCCGGCGAGGGCCAAAGCGGATCCGCCGACGATGTCCGGAATCTCGTTC
CAGGCGCGCTTCAGCAGCGATGTGGAGCCTCGGGCAGCGGATGCGGACAT
GTCGACTGATAACT
BS16023.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:24:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9034-PA | 234 | CG9034-RA | 1..234 | 250..17 | 1170 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-05 02:29:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9034-RB | 481 | CG9034-RB | 156..390 | 250..16 | 1175 | 100 | Minus |
CG9034-RA | 386 | CG9034-RA | 61..295 | 250..16 | 1175 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-05 02:29:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 9159605..9159839 | 16..250 | 1175 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-05 02:29:44 has no hits.
BS16023.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:20 Download gff for
BS16023.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-PA | 1..234 | 17..250 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 22:12:53 Download gff for
BS16023.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-RA | 61..301 | 10..250 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-05 03:06:33 Download gff for
BS16023.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-RA | 61..301 | 10..250 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-05 03:06:33 Download gff for
BS16023.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 9159599..9159839 | 10..250 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 22:12:53 Download gff for
BS16023.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 9053632..9053872 | 10..250 | 98 | | Plus |
BS16023.5prime Sequence
264 bp (264 high quality bases) assembled on 2007-04-16
> BS16023.5prime
GAAGTTATCAGTCGACATGTCCGCATCCGCTGCCCGAGGCTCCACATCGC
TGCTGAAGCGCGCCTGGAACGAGATTCCGGACATCGTCGGCGGATCCGCT
TTGGCCCTCGCCGGAATCGTTATGGCCACCATCGGAGTGGCCAACTACTA
TGCCAAGGACGGCGATAACCGACGCTACAAGCTCGGCTACGTTGTCTACC
GCCACGACGATCCGCGCGCCCTGAAGGTGCGCAACGACGAGGATGACTAG
AAGCTTTCTAGACC
BS16023.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:24:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9034-PA | 234 | CG9034-RA | 1..234 | 17..250 | 1170 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:13:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9034-RB | 481 | CG9034-RB | 156..390 | 17..251 | 1175 | 100 | Plus |
CG9034-RA | 386 | CG9034-RA | 61..295 | 17..251 | 1175 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:13:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 9159605..9159839 | 251..17 | 1175 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-12 10:13:53 has no hits.
BS16023.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:20 Download gff for
BS16023.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-PA | 1..234 | 17..250 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 21:44:11 Download gff for
BS16023.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-RA | 61..301 | 17..257 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:55:35 Download gff for
BS16023.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-RA | 61..301 | 17..257 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 12:55:35 Download gff for
BS16023.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 9159599..9159839 | 17..257 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 21:44:11 Download gff for
BS16023.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 9053632..9053872 | 17..257 | 98 | | Minus |
BS16023.complete Sequence
266 bp assembled on 2007-05-07
GenBank Submission: FJ638025
> BS16023.complete
GAAGTTATCAGTCGACATGTCCGCATCCGCTGCCCGAGGCTCCACATCGC
TGCTGAAGCGCGCCTGGAACGAGATTCCGGACATCGTCGGCGGATCCGCT
TTGGCCCTCGCCGGAATCGTTATGGCCACCATCGGAGTGGCCAACTACTA
TGCCAAGGACGGCGATAACCGACGCTACAAGCTCGGCTACGTTGTCTACC
GCCACGACGATCCGCGCGCCCTGAAGGTGCGCAACGACGAGGATGACTAG
AAGCTTTCTAGACCAT
BS16023.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:06:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9034-RB | 234 | CG9034-PB | 1..234 | 17..250 | 1170 | 100 | Plus |
CG9034-RA | 234 | CG9034-PA | 1..234 | 17..250 | 1170 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:06:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9034-RB | 481 | CG9034-RB | 156..390 | 17..251 | 1175 | 100 | Plus |
CG9034-RA | 386 | CG9034-RA | 61..295 | 17..251 | 1175 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:06:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 9159605..9159839 | 251..17 | 1175 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 20:06:26 has no hits.
BS16023.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:09:40 Download gff for
BS16023.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-RA | 1..234 | 17..250 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:13:27 Download gff for
BS16023.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-RA | 89..329 | 17..257 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:06:52 Download gff for
BS16023.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-RA | 61..294 | 17..250 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:09:41 Download gff for
BS16023.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-RA | 89..329 | 17..257 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:14:57 Download gff for
BS16023.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9034-RA | 61..294 | 17..250 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:14:57 Download gff for
BS16023.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 9159606..9159839 | 17..250 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:06:52 Download gff for
BS16023.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 9053639..9053872 | 17..250 | 100 | | Minus |
BS16023.pep Sequence
Translation from 16 to 249
> BS16023.pep
MSASAARGSTSLLKRAWNEIPDIVGGSALALAGIVMATIGVANYYAKDGD
NRRYKLGYVVYRHDDPRALKVRNDEDD*
BS16023.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:43:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9034-PB | 77 | CG9034-PB | 1..77 | 1..77 | 395 | 100 | Plus |
CG9034-PA | 77 | CG9034-PA | 1..77 | 1..77 | 395 | 100 | Plus |