Clone BS16023 Report

Search the DGRC for BS16023

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:23
Vector:pDNR-Dual
Associated Gene/TranscriptCG9034-RA
Protein status:BS16023.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16023.3prime Sequence

264 bp (264 high quality bases) assembled on 2007-04-16

> BS16023.3prime
ATGGTCTAGAAAGCTTCTAGTCATCCTCGTCGTTGCGCACCTTCAGGGCG
CGCGGATCGTCGTGGCGGTAGACAACGTAGCCGAGCTTGTAGCGTCGGTT
ATCGCCGTCCTTGGCATAGTAGTTGGCCACTCCGATGGTGGCCATAACGA
TTCCGGCGAGGGCCAAAGCGGATCCGCCGACGATGTCCGGAATCTCGTTC
CAGGCGCGCTTCAGCAGCGATGTGGAGCCTCGGGCAGCGGATGCGGACAT
GTCGACTGATAACT

BS16023.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG9034-PA 234 CG9034-RA 1..234 250..17 1170 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-05 02:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG9034-RB 481 CG9034-RB 156..390 250..16 1175 100 Minus
CG9034-RA 386 CG9034-RA 61..295 250..16 1175 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-05 02:29:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9159605..9159839 16..250 1175 100 Plus
Blast to na_te.dros performed on 2015-02-05 02:29:44 has no hits.

BS16023.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:20 Download gff for BS16023.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9034-PA 1..234 17..250 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 22:12:53 Download gff for BS16023.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 61..301 10..250 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-05 03:06:33 Download gff for BS16023.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 61..301 10..250 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-05 03:06:33 Download gff for BS16023.3prime
Subject Subject Range Query Range Percent Splice Strand
X 9159599..9159839 10..250 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 22:12:53 Download gff for BS16023.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 9053632..9053872 10..250 98   Plus

BS16023.5prime Sequence

264 bp (264 high quality bases) assembled on 2007-04-16

> BS16023.5prime
GAAGTTATCAGTCGACATGTCCGCATCCGCTGCCCGAGGCTCCACATCGC
TGCTGAAGCGCGCCTGGAACGAGATTCCGGACATCGTCGGCGGATCCGCT
TTGGCCCTCGCCGGAATCGTTATGGCCACCATCGGAGTGGCCAACTACTA
TGCCAAGGACGGCGATAACCGACGCTACAAGCTCGGCTACGTTGTCTACC
GCCACGACGATCCGCGCGCCCTGAAGGTGCGCAACGACGAGGATGACTAG
AAGCTTTCTAGACC

BS16023.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:24:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG9034-PA 234 CG9034-RA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG9034-RB 481 CG9034-RB 156..390 17..251 1175 100 Plus
CG9034-RA 386 CG9034-RA 61..295 17..251 1175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9159605..9159839 251..17 1175 100 Minus
Blast to na_te.dros performed on 2015-02-12 10:13:53 has no hits.

BS16023.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:20 Download gff for BS16023.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9034-PA 1..234 17..250 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 21:44:11 Download gff for BS16023.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 61..301 17..257 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:55:35 Download gff for BS16023.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 61..301 17..257 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 12:55:35 Download gff for BS16023.5prime
Subject Subject Range Query Range Percent Splice Strand
X 9159599..9159839 17..257 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 21:44:11 Download gff for BS16023.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 9053632..9053872 17..257 98   Minus

BS16023.complete Sequence

266 bp assembled on 2007-05-07

GenBank Submission: FJ638025

> BS16023.complete
GAAGTTATCAGTCGACATGTCCGCATCCGCTGCCCGAGGCTCCACATCGC
TGCTGAAGCGCGCCTGGAACGAGATTCCGGACATCGTCGGCGGATCCGCT
TTGGCCCTCGCCGGAATCGTTATGGCCACCATCGGAGTGGCCAACTACTA
TGCCAAGGACGGCGATAACCGACGCTACAAGCTCGGCTACGTTGTCTACC
GCCACGACGATCCGCGCGCCCTGAAGGTGCGCAACGACGAGGATGACTAG
AAGCTTTCTAGACCAT

BS16023.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG9034-RB 234 CG9034-PB 1..234 17..250 1170 100 Plus
CG9034-RA 234 CG9034-PA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:06:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG9034-RB 481 CG9034-RB 156..390 17..251 1175 100 Plus
CG9034-RA 386 CG9034-RA 61..295 17..251 1175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9159605..9159839 251..17 1175 100 Minus
Blast to na_te.dros performed on 2014-11-27 20:06:26 has no hits.

BS16023.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:09:40 Download gff for BS16023.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 1..234 17..250 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:13:27 Download gff for BS16023.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 89..329 17..257 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:06:52 Download gff for BS16023.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 61..294 17..250 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:09:41 Download gff for BS16023.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 89..329 17..257 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:14:57 Download gff for BS16023.complete
Subject Subject Range Query Range Percent Splice Strand
CG9034-RA 61..294 17..250 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:14:57 Download gff for BS16023.complete
Subject Subject Range Query Range Percent Splice Strand
X 9159606..9159839 17..250 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:06:52 Download gff for BS16023.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9053639..9053872 17..250 100   Minus

BS16023.pep Sequence

Translation from 16 to 249

> BS16023.pep
MSASAARGSTSLLKRAWNEIPDIVGGSALALAGIVMATIGVANYYAKDGD
NRRYKLGYVVYRHDDPRALKVRNDEDD*

BS16023.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG9034-PB 77 CG9034-PB 1..77 1..77 395 100 Plus
CG9034-PA 77 CG9034-PA 1..77 1..77 395 100 Plus