Clone BS16031 Report

Search the DGRC for BS16031

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptCG9344-RA
Protein status:BS16031.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16031.3prime Sequence

270 bp (270 high quality bases) assembled on 2007-04-16

> BS16031.3prime
ATGGTCTAGAAAGCTTTCAGACCCTCCGCTTCTGCGTGGAAATGTAGAGG
ACATTGTTGCCGCGGATGAAGGCGTCGCCGTACTTGTTCTTCAGCTGCCC
ATTCACGTACTCCTCCGTCTGCTCCAGGCAGATGTTCATGTAGCCATCCA
GACAGGCCAGCACACCTCGATAGTCAACGCCGTTGTTCAGCTTTACGGCG
ACGGGGCGTCCGTGTATCTGATTGATGAACTGCGACAGGGCCTCTTTGCG
GGACATGTCGACTGATAACT

BS16031.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-PA 240 CG9344-RA 1..240 256..17 1200 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-RA 474 CG9344-RA 100..340 256..16 1205 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20977315..20977466 167..16 760 100 Minus
2R 25286936 2R 20977155..20977248 256..163 470 100 Minus
Blast to na_te.dros performed 2015-02-12 17:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1c 5443 Rt1c RT1C 5443bp 3044..3102 124..67 112 67.8 Minus

BS16031.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:26 Download gff for BS16031.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9344-PA 1..240 17..256 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 17:11:52 Download gff for BS16031.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 100..340 16..256 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:37:16 Download gff for BS16031.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 100..340 16..256 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:37:16 Download gff for BS16031.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 20977155..20977245 166..256 100 -> Minus
2R 20977317..20977466 16..165 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 17:11:52 Download gff for BS16031.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16864822..16864971 16..165 100   Minus
arm_2R 16864660..16864750 166..256 100 -> Minus

BS16031.5prime Sequence

270 bp (270 high quality bases) assembled on 2007-04-16

> BS16031.5prime
GAAGTTATCAGTCGACATGTCCCGCAAAGAGGCCCTGTCGCAGTTCATCA
ATCAGATACACGGACGCCCCGTCGCCGTAAAGCTGAACAACGGCGTTGAC
TATCGAGGTGTGCTGGCCTGTCTGGATGGCTACATGAACATCTGCCTGGA
GCAGACGGAGGAGTACGTGAATGGGCAGCTGAAGAACAAGTACGGCGACG
CCTTCATCCGCGGCAACAATGTCCTCTACATTTCCACGCAGAAGCGGAGG
GTCTGAAAGCTTTCTAGACC

BS16031.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:25:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-PA 240 CG9344-RA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-RA 474 CG9344-RA 100..340 17..257 1205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20977315..20977466 106..257 760 100 Plus
2R 25286936 2R 20977155..20977248 17..110 470 100 Plus
Blast to na_te.dros performed 2015-02-11 04:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1c 5443 Rt1c RT1C 5443bp 3044..3102 149..206 112 67.8 Plus

BS16031.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:26 Download gff for BS16031.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9344-PA 1..240 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 09:11:20 Download gff for BS16031.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 100..340 17..257 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:08:47 Download gff for BS16031.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 100..340 17..257 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:08:47 Download gff for BS16031.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 20977155..20977245 17..107 100 -> Plus
2R 20977317..20977466 108..257 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 09:11:20 Download gff for BS16031.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16864660..16864750 17..107 100 -> Plus
arm_2R 16864822..16864971 108..257 100   Plus

BS16031.complete Sequence

272 bp assembled on 2007-05-07

GenBank Submission: FJ638027

> BS16031.complete
GAAGTTATCAGTCGACATGTCCCGCAAAGAGGCCCTGTCGCAGTTCATCA
ATCAGATACACGGACGCCCCGTCGCCGTAAAGCTGAACAACGGCGTTGAC
TATCGAGGTGTGCTGGCCTGTCTGGATGGCTACATGAACATCTGCCTGGA
GCAGACGGAGGAGTACGTGAATGGGCAGCTGAAGAACAAGTACGGCGACG
CCTTCATCCGCGGCAACAATGTCCTCTACATTTCCACGCAGAAGCGGAGG
GTCTGAAAGCTTTCTAGACCAT

BS16031.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:47:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-RA 240 CG9344-PA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:47:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-RA 474 CG9344-RA 100..340 17..257 1205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:47:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20977315..20977466 106..257 760 100 Plus
2R 25286936 2R 20977155..20977248 17..110 470 100 Plus
Blast to na_te.dros performed 2014-11-27 23:47:30
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1c 5443 Rt1c RT1C 5443bp 3044..3102 149..206 112 67.8 Plus

BS16031.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:50:17 Download gff for BS16031.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 1..240 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:59:03 Download gff for BS16031.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 100..340 17..257 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:38:00 Download gff for BS16031.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 100..338 17..255 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:50:17 Download gff for BS16031.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 100..340 17..257 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:08:15 Download gff for BS16031.complete
Subject Subject Range Query Range Percent Splice Strand
CG9344-RA 100..338 17..255 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:08:15 Download gff for BS16031.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20977155..20977245 17..107 100 -> Plus
2R 20977317..20977464 108..255 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:38:00 Download gff for BS16031.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16864660..16864750 17..107 100 -> Plus
arm_2R 16864822..16864969 108..255 100   Plus

BS16031.pep Sequence

Translation from 16 to 255

> BS16031.pep
MSRKEALSQFINQIHGRPVAVKLNNGVDYRGVLACLDGYMNICLEQTEEY
VNGQLKNKYGDAFIRGNNVLYISTQKRRV*

BS16031.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG9344-PA 79 CG9344-PA 1..79 1..79 412 100 Plus
SmF-PA 88 CG16792-PA 12..74 10..72 161 49.2 Plus