Clone BS16033 Report

Search the DGRC for BS16033

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:33
Vector:pDNR-Dual
Associated Gene/TranscriptCG17298-RA
Protein status:BS16033.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16033.3prime Sequence

318 bp (318 high quality bases) assembled on 2007-04-16

> BS16033.3prime
ATGGTCTAGAAAGCTTTTAATGATGCACGACGACGGCGGGGGCGGCATGA
TGCACTGGAACCAATGGAACCACCGGCCTGACAGCATGCACCGCCACCAC
GGGCTTGTGGACGACGGGTGTGATGACCTTGACGGCTGCCGGATGATGAA
CAACATGGGAGTGCACCGAGTGGGCTCCATGATGGATGATGGGCGTGTGG
ACCACCGCCGGGTGCGCCACCACGGGTGCCACGGCCACCACGCCGGGATG
GGCGATAGCCTGAGAGGCGACGAAGGCGGCGAGCACGAACAGTACTTTGA
ACATGTCGACTGATAACT

BS16033.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:25:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG17298-PA 288 CG17298-RA 1..288 304..17 1440 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG17298-RA 495 CG17298-RA 79..366 304..17 1440 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21283780..21283921 158..17 710 100 Minus
3R 32079331 3R 21283584..21283717 292..159 670 100 Minus
Blast to na_te.dros performed on 2015-02-12 17:15:51 has no hits.

BS16033.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:27 Download gff for BS16033.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17298-PA 1..288 17..304 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 17:11:55 Download gff for BS16033.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 74..370 13..309 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:38:09 Download gff for BS16033.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 74..370 13..309 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:38:09 Download gff for BS16033.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 21283584..21283717 159..292 100 -> Minus
3R 21283780..21283925 13..158 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 17:11:55 Download gff for BS16033.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17109306..17109439 159..292 100 -> Minus
arm_3R 17109502..17109647 13..158 98   Minus

BS16033.5prime Sequence

318 bp (318 high quality bases) assembled on 2007-04-16

> BS16033.5prime
GAAGTTATCAGTCGACATGTTCAAAGTACTGTTCGTGCTCGCCGCCTTCG
TCGCCTCTCAGGCTATCGCCCATCCCGGCGTGGTGGCCGTGGCACCCGTG
GTGGCGCACCCGGCGGTGGTCCACACGCCCATCATCCATCATGGAGCCCA
CTCGGTGCACTCCCATGTTGTTCATCATCCGGCAGCCGTCAAGGTCATCA
CACCCGTCGTCCACAAGCCCGTGGTGGCGGTGCATGCTGTCAGGCCGGTG
GTTCCATTGGTTCCAGTGCATCATGCCGCCCCCGCCGTCGTCGTGCATCA
TTAAAAGCTTTCTAGACC

BS16033.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:26:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG17298-PA 288 CG17298-RA 1..288 17..304 1440 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG17298-RA 495 CG17298-RA 79..366 17..304 1440 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21283780..21283921 163..304 710 100 Plus
3R 32079331 3R 21283584..21283717 29..162 670 100 Plus
Blast to na_te.dros performed on 2015-02-13 06:29:49 has no hits.

BS16033.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:27 Download gff for BS16033.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17298-PA 1..288 17..304 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 19:49:21 Download gff for BS16033.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 74..370 12..308 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:41:01 Download gff for BS16033.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 74..370 12..308 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 08:41:01 Download gff for BS16033.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 21283584..21283717 29..162 100 -> Plus
3R 21283780..21283925 163..308 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 19:49:21 Download gff for BS16033.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17109306..17109439 29..162 100 -> Plus
arm_3R 17109502..17109647 163..308 98   Plus

BS16033.complete Sequence

320 bp assembled on 2007-05-07

GenBank Submission: FJ638029

> BS16033.complete
GAAGTTATCAGTCGACATGTTCAAAGTACTGTTCGTGCTCGCCGCCTTCG
TCGCCTCTCAGGCTATCGCCCATCCCGGCGTGGTGGCCGTGGCACCCGTG
GTGGCGCACCCGGCGGTGGTCCACACGCCCATCATCCATCATGGAGCCCA
CTCGGTGCACTCCCATGTTGTTCATCATCCGGCAGCCGTCAAGGTCATCA
CACCCGTCGTCCACAAGCCCGTGGTGGCGGTGCATGCTGTCAGGCCGGTG
GTTCCATTGGTTCCAGTGCATCATGCCGCCCCCGCCGTCGTCGTGCATCA
TTAAAAGCTTTCTAGACCAT

BS16033.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:40:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG17298-RA 288 CG17298-PA 1..288 17..304 1440 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG17298-RA 495 CG17298-RA 79..366 17..304 1440 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:40:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21283780..21283921 163..304 710 100 Plus
3R 32079331 3R 21283584..21283717 29..162 670 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:40:10 has no hits.

BS16033.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:36:27 Download gff for BS16033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 1..288 17..304 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:16:02 Download gff for BS16033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 74..370 12..308 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:29:12 Download gff for BS16033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 84..364 22..302 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:36:27 Download gff for BS16033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 74..370 12..308 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:35:59 Download gff for BS16033.complete
Subject Subject Range Query Range Percent Splice Strand
CG17298-RA 84..364 22..302 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:35:59 Download gff for BS16033.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21283579..21283717 22..162 97 -> Plus
3R 21283780..21283919 163..302 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:29:12 Download gff for BS16033.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17109301..17109439 22..162 97 -> Plus
arm_3R 17109502..17109641 163..302 100   Plus

BS16033.pep Sequence

Translation from 16 to 303

> BS16033.pep
MFKVLFVLAAFVASQAIAHPGVVAVAPVVAHPAVVHTPIIHHGAHSVHSH
VVHHPAAVKVITPVVHKPVVAVHAVRPVVPLVPVHHAAPAVVVHH*

BS16033.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG17298-PA 95 CG17298-PA 1..95 1..95 495 100 Plus