Clone BS16037 Report

Search the DGRC for BS16037

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptRpL37A-RA
Protein status:BS16037.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16037.3prime Sequence

309 bp (309 high quality bases) assembled on 2007-04-16

> BS16037.3prime
ATGGTCTAGAAAGCTTTTACTGTTCCTTGGTTTCACGCAGACGACGGACG
GCGGATCGCACGGAGGCGGCGGCGGTGGTGGAGTACACCCAGGCGCCACC
GGCGACGGTCCTTTTGCAGCGCTTGCAGGACCAGATGCCCACAACGGCGC
GCTTCATGGAGTCCTTGCCGCAGAAGGAGCAAGTGTACTTGCTGTGCTGG
GTGATTTCCATCTTCTTGACCATCTTACGCAGGGAGGCACCATAACGGGT
ACCATATTTACCAACGATTCCAACCTTCTTGGTGCGCTTGGCCATGTCGA
CTGATAACT

BS16037.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG5827-PA 279 RpL37A-RA 1..279 295..17 1395 100 Minus
CG5827-PB 279 RpL37A-RB 1..279 295..17 1395 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37A-RA 511 CG5827-RA 84..363 295..16 1400 100 Minus
RpL37A-RB 583 CG5827-RB 156..435 295..16 1400 100 Minus
RpL37A-RC 705 CG5827-RC 127..406 295..16 1400 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5071607..5071756 165..16 750 100 Minus
2L 23513712 2L 5071226..5071356 293..163 655 100 Minus
Blast to na_te.dros performed 2015-02-13 06:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
R1A1-element 5356 R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). 894..927 85..52 107 79.4 Minus

BS16037.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:29 Download gff for BS16037.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5827-PB 1..279 17..295 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 19:49:29 Download gff for BS16037.3prime
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RC 120..406 16..303 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:43:50 Download gff for BS16037.3prime
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RC 120..406 16..303 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 08:43:50 Download gff for BS16037.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 5071214..5071355 164..307 96 -> Minus
2L 5071609..5071756 16..163 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 19:49:29 Download gff for BS16037.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5071214..5071355 164..307 96 -> Minus
arm_2L 5071609..5071756 16..163 100   Minus

BS16037.5prime Sequence

309 bp (309 high quality bases) assembled on 2007-04-16

> BS16037.5prime
GAAGTTATCAGTCGACATGGCCAAGCGCACCAAGAAGGTTGGAATCGTTG
GTAAATATGGTACCCGTTATGGTGCCTCCCTGCGTAAGATGGTCAAGAAG
ATGGAAATCACCCAGCACAGCAAGTACACTTGCTCCTTCTGCGGCAAGGA
CTCCATGAAGCGCGCCGTTGTGGGCATCTGGTCCTGCAAGCGCTGCAAAA
GGACCGTCGCCGGTGGCGCCTGGGTGTACTCCACCACCGCCGCCGCCTCC
GTGCGATCCGCCGTCCGTCGTCTGCGTGAAACCAAGGAACAGTAAAAGCT
TTCTAGACC

BS16037.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:26:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG5827-PA 279 RpL37A-RA 1..279 17..295 1395 100 Plus
CG5827-PB 279 RpL37A-RB 1..279 17..295 1395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37A-RA 511 CG5827-RA 84..363 17..296 1400 100 Plus
RpL37A-RB 583 CG5827-RB 156..435 17..296 1400 100 Plus
RpL37A-RC 705 CG5827-RC 127..406 17..296 1400 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5071607..5071756 147..296 750 100 Plus
2L 23513712 2L 5071226..5071356 19..149 655 100 Plus
Blast to na_te.dros performed 2015-02-12 17:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
R1A1-element 5356 R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). 894..927 227..260 107 79.4 Plus

BS16037.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:30 Download gff for BS16037.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5827-PB 1..279 17..295 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 17:11:57 Download gff for BS16037.5prime
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RC 120..406 9..296 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:38:29 Download gff for BS16037.5prime
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RC 120..406 9..296 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:38:29 Download gff for BS16037.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 5071609..5071756 149..296 100   Plus
2L 5071214..5071355 5..148 96 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 17:11:57 Download gff for BS16037.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5071214..5071355 5..148 96 -> Plus
arm_2L 5071609..5071756 149..296 100   Plus

BS16037.complete Sequence

311 bp assembled on 2007-05-07

GenBank Submission: FJ638031

> BS16037.complete
GAAGTTATCAGTCGACATGGCCAAGCGCACCAAGAAGGTTGGAATCGTTG
GTAAATATGGTACCCGTTATGGTGCCTCCCTGCGTAAGATGGTCAAGAAG
ATGGAAATCACCCAGCACAGCAAGTACACTTGCTCCTTCTGCGGCAAGGA
CTCCATGAAGCGCGCCGTTGTGGGCATCTGGTCCTGCAAGCGCTGCAAAA
GGACCGTCGCCGGTGGCGCCTGGGTGTACTCCACCACCGCCGCCGCCTCC
GTGCGATCCGCCGTCCGTCGTCTGCGTGAAACCAAGGAACAGTAAAAGCT
TTCTAGACCAT

BS16037.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37A-RA 279 CG5827-PA 1..279 17..295 1395 100 Plus
RpL37A-RB 279 CG5827-PB 1..279 17..295 1395 100 Plus
RpL37A-RC 279 CG5827-PC 1..279 17..295 1395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37A-RA 511 CG5827-RA 84..363 17..296 1400 100 Plus
RpL37A-RB 583 CG5827-RB 156..435 17..296 1400 100 Plus
RpL37A-RC 705 CG5827-RC 127..406 17..296 1400 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5071607..5071756 147..296 750 100 Plus
2L 23513712 2L 5071226..5071356 19..149 655 100 Plus
Blast to na_te.dros performed 2014-11-27 15:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
R1A1-element 5356 R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). 894..927 227..260 107 79.4 Plus

BS16037.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:49:44 Download gff for BS16037.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RB 1..279 17..295 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:38:12 Download gff for BS16037.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RB 111..397 9..296 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:50:42 Download gff for BS16037.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RC 127..403 17..293 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:49:44 Download gff for BS16037.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RB 111..397 9..296 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:09:24 Download gff for BS16037.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RC 127..403 17..293 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:09:24 Download gff for BS16037.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5071225..5071355 17..148 99 -> Plus
2L 5071609..5071753 149..293 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:50:42 Download gff for BS16037.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5071225..5071355 17..148 99 -> Plus
arm_2L 5071609..5071753 149..293 100   Plus

BS16037.pep Sequence

Translation from 16 to 294

> BS16037.pep
MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRA
VVGIWSCKRCKRTVAGGAWVYSTTAAASVRSAVRRLRETKEQ*

BS16037.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37A-PA 92 CG5827-PA 1..92 1..92 478 100 Plus
RpL37A-PB 92 CG5827-PB 1..92 1..92 478 100 Plus
RpL37A-PC 92 CG5827-PC 1..92 1..92 478 100 Plus