Clone BS16046 Report

Search the DGRC for BS16046

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:46
Vector:pDNR-Dual
Associated Gene/Transcriptobsolete transcript model
Protein status:BS16046.pep: validated full length
Sequenced Size:16

Clone Sequence Records

BS16046.3prime Sequence

246 bp (246 high quality bases) assembled on 2007-04-16

> BS16046.3prime
ATGGTCTAGAAAGCTTTTATTGAAAATGTGGGAAATGTTGGGGCGCCGTG
TGTCTGTCGCAGGATGTGTGCGTCGTAATGTCCGTGGTTTTTGGGGGCCA
GGATGTCGTACTACTGGGGATAGTGAGAGGTAGTAGGTAGTAGGTAGTAG
GTAGAAGGACTGAGGCTGAGGTCGAGGTTGAGAGGTTGAGCTTAGTCACC
GGACCGTTGATATGGCAACTCCATTGATTCATGTCGACTGATAACT

BS16046.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG32714-PA 216 CG32714-RA 1..216 232..17 1080 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG33181-RF 4113 CG32714-RF 274..491 232..15 1090 100 Minus
CG33181-RI 3920 CG33181-RI 176..376 215..15 1005 100 Minus
CG33181-RH 4107 CG33181-RH 285..485 215..15 1005 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8509455..8509656 216..15 1010 100 Minus
Blast to na_te.dros performed 2015-02-10 15:37:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsil\Loa 7779 Dsil\Loa DSV28T24 7779bp AKA(S39346) Derived from X60177 (Rel. 37, Last updated, Version 8). 5661..5691 13..43 101 80.6 Plus

BS16046.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:35 Download gff for BS16046.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32714-PA 1..216 17..232 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 06:55:25 Download gff for BS16046.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 271..491 15..235 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:26:25 Download gff for BS16046.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 271..491 15..235 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:26:25 Download gff for BS16046.3prime
Subject Subject Range Query Range Percent Splice Strand
X 8489618..8489637 216..235 95 -> Minus
X 8509456..8509656 15..215 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 06:55:25 Download gff for BS16046.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 8383651..8383670 216..235 95 -> Minus
arm_X 8403489..8403689 15..215 100   Minus

BS16046.5prime Sequence

246 bp (246 high quality bases) assembled on 2007-04-16

> BS16046.5prime
GAAGTTATCAGTCGACATGAATCAATGGAGTTGCCATATCAACGGTCCGG
TGACTAAGCTCAACCTCTCAACCTCGACCTCAGCCTCAGTCCTTCTACCT
ACTACCTACTACCTACTACCTCTCACTATCCCCAGTAGTACGACATCCTG
GCCCCCAAAAACCACGGACATTACGACGCACACATCCTGCGACAGACACA
CGGCGCCCCAACATTTCCCACATTTTCAATAAAAGCTTTCTAGACC

BS16046.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG32714-PA 216 CG32714-RA 1..216 17..232 1080 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 13:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG33181-RF 4113 CG32714-RF 274..491 17..234 1090 100 Plus
CG33181-RI 3920 CG33181-RI 176..376 34..234 1005 100 Plus
CG33181-RH 4107 CG33181-RH 285..485 34..234 1005 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 13:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8509455..8509656 33..234 1010 100 Plus
Blast to na_te.dros performed 2015-02-13 13:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsil\Loa 7779 Dsil\Loa DSV28T24 7779bp AKA(S39346) Derived from X60177 (Rel. 37, Last updated, Version 8). 5661..5691 236..206 101 80.6 Minus

BS16046.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:35 Download gff for BS16046.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32714-PA 1..216 17..232 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 18:53:25 Download gff for BS16046.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 271..491 14..234 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:28:19 Download gff for BS16046.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 271..491 14..234 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 15:28:19 Download gff for BS16046.5prime
Subject Subject Range Query Range Percent Splice Strand
X 8489618..8489637 14..33 95 -> Plus
X 8509456..8509656 34..234 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 18:53:25 Download gff for BS16046.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 8383651..8383670 14..33 95 -> Plus
arm_X 8403489..8403689 34..234 100   Plus

BS16046.complete Sequence

248 bp assembled on 2007-05-07

> BS16046.complete
GAAGTTATCAGTCGACATGAATCAATGGAGTTGCCATATCAACGGTCCGG
TGACTAAGCTCAACCTCTCAACCTCGACCTCAGCCTCAGTCCTTCTACCT
ACTACCTACTACCTACTACCTCTCACTATCCCCAGTAGTACGACATCCTG
GCCCCCAAAAACCACGGACATTACGACGCACACATCCTGCGACAGACACA
CGGCGCCCCAACATTTCCCACATTTTCAATAAAAGCTTTCTAGACCAT

BS16046.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 08:01:53 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG33181-RF 4113 CG32714-RF 274..491 17..234 1090 100 Plus
CG33181-RI 3920 CG33181-RI 176..376 34..234 1005 100 Plus
CG33181-RH 4107 CG33181-RH 285..485 34..234 1005 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8509455..8509656 33..234 1010 100 Plus
Blast to na_te.dros performed 2014-11-28 08:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsil\Loa 7779 Dsil\Loa DSV28T24 7779bp AKA(S39346) Derived from X60177 (Rel. 37, Last updated, Version 8). 5661..5691 236..206 101 80.6 Minus

BS16046.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 15:08:00 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:38:33 Download gff for BS16046.complete
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 273..486 17..230 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:12:46 Download gff for BS16046.complete
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 274..487 17..230 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:08:00 Download gff for BS16046.complete
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 270..490 14..234 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:09:26 Download gff for BS16046.complete
Subject Subject Range Query Range Percent Splice Strand
CG33181-RF 274..487 17..230 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:09:26 Download gff for BS16046.complete
Subject Subject Range Query Range Percent Splice Strand
X 8489621..8489637 17..33 100 -> Plus
X 8509456..8509652 34..230 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:12:46 Download gff for BS16046.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8383654..8383670 17..33 100 -> Plus
arm_X 8403489..8403685 34..230 100   Plus

BS16046.pep Sequence

Translation from 16 to 231

> BS16046.pep
MNQWSCHINGPVTKLNLSTSTSASVLLPTTYYLLPLTIPSSTTSWPPKTT
DITTHTSCDRHTAPQHFPHFQ*
Sequence BS16046.pep has no blast hits.