Clone BS16048 Report

Search the DGRC for BS16048

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptCG7646-RB
Protein status:BS16048.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16048.3prime Sequence

267 bp (267 high quality bases) assembled on 2007-04-16

> BS16048.3prime
ATGGTCTAGAAAGCTTTTATGGTGCCAACATTTTTGACAACTCCTCATCT
TGCAAGCATCCTTTCAAGAACTCATCTTGGGTTAATTGACCATCGTTATT
TTCGTCCATTTTTGCAAAAATATTTTTTGCTCTTTCTTCTGCTGAATCAG
CTGGACGATTAGATGAGCACGCTCCTAGCATGTCATAAATTGCCTGAACA
ATTTTGGTCATTTCTTGTATGTCTATAACACCATTGCCATCGACATCGTA
CATGTCGACTGATAACT

BS16048.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-PA 561 CG7646-RA 325..561 253..17 1185 100 Minus
CG7646-PB 237 CG7646-RB 1..237 253..17 1185 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:04:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-RC 1696 CG7646-RC 996..1233 253..16 1190 100 Minus
CG7646-RB 627 CG7646-RB 284..521 253..16 1190 100 Minus
CG7646-RA 970 CG7646-RA 627..864 253..16 1190 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19995625..19995806 197..16 910 100 Minus
3L 28110227 3L 19995443..19995503 253..193 305 100 Minus
Blast to na_te.dros performed on 2015-02-12 05:04:21 has no hits.

BS16048.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:36 Download gff for BS16048.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7646-PB 1..237 17..253 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 07:20:03 Download gff for BS16048.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 623..864 16..258 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:31:44 Download gff for BS16048.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 623..864 16..258 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:31:44 Download gff for BS16048.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 19995439..19995502 194..258 98 -> Minus
3L 19995629..19995806 16..193 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 07:20:03 Download gff for BS16048.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19988539..19988602 194..258 98 -> Minus
arm_3L 19988729..19988906 16..193 100   Minus

BS16048.5prime Sequence

267 bp (267 high quality bases) assembled on 2007-04-16

> BS16048.5prime
GAAGTTATCAGTCGACATGTACGATGTCGATGGCAATGGTGTTATAGACA
TACAAGAAATGACCAAAATTGTTCAGGCAATTTATGACATGCTAGGAGCG
TGCTCATCTAATCGTCCAGCTGATTCAGCAGAAGAAAGAGCAAAAAATAT
TTTTGCAAAAATGGACGAAAATAACGATGGTCAATTAACCCAAGATGAGT
TCTTGAAAGGATGCTTGCAAGATGAGGAGTTGTCAAAAATGTTGGCACCA
TAAAAGCTTTCTAGACC

BS16048.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-PA 561 CG7646-RA 325..561 17..253 1185 100 Plus
CG7646-PB 237 CG7646-RB 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-RC 1696 CG7646-RC 996..1233 17..254 1190 100 Plus
CG7646-RB 627 CG7646-RB 284..521 17..254 1190 100 Plus
CG7646-RA 970 CG7646-RA 627..864 17..254 1190 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19995625..19995806 73..254 910 100 Plus
3L 28110227 3L 19995443..19995503 17..77 305 100 Plus
Blast to na_te.dros performed on 2015-02-11 23:07:12 has no hits.

BS16048.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:36 Download gff for BS16048.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7646-PB 1..237 17..253 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 04:44:14 Download gff for BS16048.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 623..864 12..254 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:31:05 Download gff for BS16048.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 623..864 12..254 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:31:05 Download gff for BS16048.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 19995439..19995502 12..76 98 -> Plus
3L 19995629..19995806 77..254 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 04:44:14 Download gff for BS16048.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19988539..19988602 12..76 98 -> Plus
arm_3L 19988729..19988906 77..254 100   Plus

BS16048.complete Sequence

269 bp assembled on 2007-05-07

GenBank Submission: FJ638036

> BS16048.complete
GAAGTTATCAGTCGACATGTACGATGTCGATGGCAATGGTGTTATAGACA
TACAAGAAATGACCAAAATTGTTCAGGCAATTTATGACATGCTAGGAGCG
TGCTCATCTAATCGTCCAGCTGATTCAGCAGAAGAAAGAGCAAAAAATAT
TTTTGCAAAAATGGACGAAAATAACGATGGTCAATTAACCCAAGATGAGT
TCTTGAAAGGATGCTTGCAAGATGAGGAGTTGTCAAAAATGTTGGCACCA
TAAAAGCTTTCTAGACCAT

BS16048.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-RC 561 CG7646-PC 325..561 17..253 1185 100 Plus
CG7646-RB 237 CG7646-PB 1..237 17..253 1185 100 Plus
CG7646-RA 561 CG7646-PA 325..561 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-RC 1696 CG7646-RC 996..1233 17..254 1190 100 Plus
CG7646-RB 627 CG7646-RB 284..521 17..254 1190 100 Plus
CG7646-RA 970 CG7646-RA 627..864 17..254 1190 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19995625..19995806 73..254 910 100 Plus
3L 28110227 3L 19995443..19995503 17..77 305 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:31:07 has no hits.

BS16048.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:20:29 Download gff for BS16048.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 321..561 12..253 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:01:39 Download gff for BS16048.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 321..562 12..254 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:00:42 Download gff for BS16048.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 627..861 17..251 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:20:29 Download gff for BS16048.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 321..562 12..254 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:03:19 Download gff for BS16048.complete
Subject Subject Range Query Range Percent Splice Strand
CG7646-RA 627..861 17..251 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:03:19 Download gff for BS16048.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19995443..19995502 17..76 100 -> Plus
3L 19995629..19995803 77..251 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:00:42 Download gff for BS16048.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19988543..19988602 17..76 100 -> Plus
arm_3L 19988729..19988903 77..251 100   Plus

BS16048.pep Sequence

Translation from 16 to 252

> BS16048.pep
MYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRPADSAEERAKNIFAKMD
ENNDGQLTQDEFLKGCLQDEELSKMLAP*

BS16048.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG7646-PB 78 CG7646-PB 1..78 1..78 402 100 Plus
CG7646-PC 186 CG7646-PC 109..186 1..78 402 100 Plus
CG7646-PA 186 CG7646-PA 109..186 1..78 402 100 Plus
Nca-PA 190 CG7641-PA 107..183 1..76 163 44.9 Plus
CG44422-PE 363 CG44422-PE 280..357 1..77 158 38.5 Plus