Clone BS16052 Report

Search the DGRC for BS16052

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptFis1-RA
Protein status:BS16052.pep: full length peptide match
Sequenced Size:329

Clone Sequence Records

BS16052.complete Sequence

329 bp assembled on 2010-02-09

GenBank Submission: KX803639

> BS16052.complete
GAAGTTATCAGTCGACATGATTTTGGAGGAACTGGCTCGTACGCATCCAG
ATGGAAGGCGTGACTATATATATTATCTTGCGTTTGGTAATGCTCGTATC
AAGGAGTATACGTCTGGCTTAAAATACTGCCGAGCTTTTCTTGACATCGA
GTCAAATGATCAAGTTCGCTCCCTAGAGGAATATATTAAAAAAGAAATCG
ATAAGGAAGTGGCAAAGGGTATGGTGGTTGCAGGCGGAGCAGCTTTAGTA
CTTGGCGGAATATTAGGACTTGGCATTGCTATGGCTAGAAATAAACAAAA
ACGGGAGAAATAGAAGCTTTCTAGACCAT

BS16052.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 04:32:13
Subject Length Description Subject Range Query Range Score Percent Strand
Fis1-RG 297 CG17510-PG 1..297 17..313 1485 100 Plus
Fis1-RC 465 CG17510-PC 169..465 17..313 1485 100 Plus
Fis1-RA 297 CG17510-PA 1..297 17..313 1485 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 04:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
Fis1-RG 557 CG17510-RG 108..404 17..313 1485 100 Plus
Fis1-RC 698 CG17510-RC 249..545 17..313 1485 100 Plus
Fis1-RA 630 CG17510-RA 181..477 17..313 1485 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 04:32:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5604243..5604405 179..17 815 100 Minus
2R 25286936 2R 5603900..5604014 291..177 575 100 Minus
Blast to na_te.dros performed on 2014-11-28 04:32:12 has no hits.

BS16052.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 18:12:04 Download gff for BS16052.complete
Subject Subject Range Query Range Percent Splice Strand
CG17510-RC 243..533 17..307 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:01:22 Download gff for BS16052.complete
Subject Subject Range Query Range Percent Splice Strand
Fis1-RA 181..471 17..307 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:03:07 Download gff for BS16052.complete
Subject Subject Range Query Range Percent Splice Strand
CG17510-RC 243..533 17..307 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:31:09 Download gff for BS16052.complete
Subject Subject Range Query Range Percent Splice Strand
Fis1-RA 181..471 17..307 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 05:31:09 Download gff for BS16052.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5603746..5603761 292..307 100 <- Minus
2R 5603900..5604012 179..291 100 <- Minus
2R 5604244..5604405 17..178 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:01:22 Download gff for BS16052.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1491251..1491266 292..307 100 <- Minus
arm_2R 1491405..1491517 179..291 100 <- Minus
arm_2R 1491749..1491910 17..178 100   Minus

BS16052.5prime Sequence

327 bp (327 high quality bases) assembled on 2007-04-16

> BS16052.5prime
GAAGTTATCCGTCGACATGATTTTGGAGGAACTGGCTCGTACGCATCCAG
ATGGAAGGCGTGACTATATATATTATCTTGCGTTTGGTAATGCTCGTATC
AAGGAGTATACGTCTGGCTTAAAATACTGCCGAGCTTTTCTTGACATCGA
GTCAAATGATCAAGTTCGCTCCCTAGAGGAATATATTAAAAAAGAAATCG
ATAAGGAAGTGGCAAAGGGTATGGTGGTTGCAGGCGGAGCAGCTTTAGTA
CTTGGCGGAATATTAGGACTTGGCATTGCTATGGCTAGAAATAAACAAAA
ACGGGAGAAATAGAAGCTTTCTAGACC

BS16052.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:29:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG17510-PA 297 CG17510-RA 1..297 17..313 1485 100 Plus
CG17510-PB 279 CG17510-RB 1..275 17..291 1375 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
Fis1-RG 557 CG17510-RG 108..404 17..313 1485 100 Plus
Fis1-RC 698 CG17510-RC 249..545 17..313 1485 100 Plus
Fis1-RA 630 CG17510-RA 181..477 17..313 1485 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:04:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5604243..5604405 179..17 815 100 Minus
2R 25286936 2R 5603900..5604014 291..177 575 100 Minus
Blast to na_te.dros performed on 2015-02-12 05:04:39 has no hits.

BS16052.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:38 Download gff for BS16052.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17510-PA 1..297 17..313 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 07:20:06 Download gff for BS16052.5prime
Subject Subject Range Query Range Percent Splice Strand
Fis1-RA 181..477 17..313 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:31:46 Download gff for BS16052.5prime
Subject Subject Range Query Range Percent Splice Strand
Fis1-RA 181..477 17..313 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:31:46 Download gff for BS16052.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 5603740..5603761 292..313 100 <- Minus
2R 5603900..5604012 179..291 100 <- Minus
2R 5604244..5604405 17..178 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 07:20:06 Download gff for BS16052.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1491245..1491266 292..313 100 <- Minus
arm_2R 1491405..1491517 179..291 100 <- Minus
arm_2R 1491749..1491910 17..178 100   Minus

BS16052.3prime Sequence

336 bp (245 high quality bases) assembled on 2007-04-16

> BS16052.3prime
ATGGTCTAGAAAGCTTCTATCTCTCCCGTTTTTGTTTATTTCTAGCCATA
GCAATGCCAAGTCCTAATATTCCGCCAAGTACTAAAGCTGCTCCGCCTGC
AACCACCATACCCTTTGCCACTTCCTTATCGATTTCTTTTTTAATATATT
CCTCTAGGGAGCGAACTTGATCATTTGACTCGATGTCAAGAAAAGCTCGG
CAGTATTTTAAGCCAGACGTATACTCCTTGATACGAGCATTACCAAACGC
AAGATAATATATATAGTCACGCCTTCCATCTGGATGCGTACGAGCCAGTT
CCTCCAAAAACATGTCGACTGATAACTTCCTAAAAG

BS16052.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:29:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG17510-PA 297 CG17510-RA 5..292 309..22 1440 100 Minus
CG17510-PB 279 CG17510-RB 5..275 309..39 1355 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
Fis1-RG 557 CG17510-RG 108..404 313..17 1455 99.3 Minus
Fis1-RC 698 CG17510-RC 249..545 313..17 1455 99.3 Minus
Fis1-RA 630 CG17510-RA 181..477 313..17 1455 99.3 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5604243..5604405 151..313 800 99.4 Plus
2R 25286936 2R 5603900..5604014 39..153 575 100 Plus
Blast to na_te.dros performed on 2015-02-13 01:40:42 has no hits.

BS16052.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:38 Download gff for BS16052.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17510-PA 1..297 17..313 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 00:13:31 Download gff for BS16052.3prime
Subject Subject Range Query Range Percent Splice Strand
Fis1-RA 181..477 17..313 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:24:04 Download gff for BS16052.3prime
Subject Subject Range Query Range Percent Splice Strand
Fis1-RA 181..477 17..313 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:24:04 Download gff for BS16052.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 5603740..5603761 17..38 95 <- Plus
2R 5603900..5604012 39..151 100 <- Plus
2R 5604244..5604405 152..313 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 00:13:31 Download gff for BS16052.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1491245..1491266 17..38 95 <- Plus
arm_2R 1491405..1491517 39..151 100 <- Plus
arm_2R 1491749..1491910 152..313 99   Plus

BS16052.pep Sequence

Translation from 16 to 312

> BS16052.pep
MILEELARTHPDGRRDYIYYLAFGNARIKEYTSGLKYCRAFLDIESNDQV
RSLEEYIKKEIDKEVAKGMVVAGGAALVLGGILGLGIAMARNKQKREK*

BS16052.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Fis1-PG 98 CG17510-PG 1..98 1..98 495 100 Plus
Fis1-PA 98 CG17510-PA 1..98 1..98 495 100 Plus
Fis1-PC 154 CG17510-PC 57..154 1..98 495 100 Plus
Fis1-PF 92 CG17510-PF 1..91 1..91 459 100 Plus
Fis1-PD 92 CG17510-PD 1..91 1..91 459 100 Plus