Clone BS16055 Report

Search the DGRC for BS16055

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:55
Vector:pDNR-Dual
Associated Gene/TranscriptCG32736-RA
Protein status:BS16055.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16055.5prime Sequence

270 bp (270 high quality bases) assembled on 2007-04-16

> BS16055.5prime
GAAGTTATCAGTCGACATGAGTCCGTACAGCGGATCCGTGCGTCGTCTGC
TGGACAGTTGGCCAGGAAAGAAGCGCTTCGGTGTCTACCGCTTCCTGCCG
CTCTTCTTTTTACTGGGCGCCGGCCTGGAATTCTCCATGATCAATTGGAC
AGTGGGCGAGACCAATTTCTACCGCACTTTTAAGCGCCGCCAGGCGAAGA
ACTACGTGGAAGAGCAGCAGCATCTGCAGGCGCGAGCCGCGAATAACACC
AACTAAAAGCTTTCTAGACC

BS16055.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:30:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG32736-PA 240 CG32736-RA 1..240 17..256 1200 100 Plus
CG32736-PB 240 CG32736-RB 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG42308-RB 640 CG42308-RB 165..406 15..256 1210 100 Plus
CG42308-RA 635 CG42308-RA 160..401 15..256 1210 100 Plus
CG32736-RB 635 CG32736-RB 160..401 15..256 1210 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7011601..7011756 15..170 780 100 Plus
X 23542271 X 7011818..7011903 171..256 430 100 Plus
Blast to na_te.dros performed on 2015-02-11 15:58:42 has no hits.

BS16055.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:41 Download gff for BS16055.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32736-PB 1..240 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 20:24:30 Download gff for BS16055.5prime
Subject Subject Range Query Range Percent Splice Strand
CG42308-RB 112..355 15..260 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:31:37 Download gff for BS16055.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32736-RB 160..403 15..260 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:31:37 Download gff for BS16055.5prime
Subject Subject Range Query Range Percent Splice Strand
X 7011601..7011756 15..170 100 -> Plus
X 7011818..7011905 171..260 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 20:24:30 Download gff for BS16055.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 6905634..6905789 15..170 100 -> Plus
arm_X 6905851..6905938 171..260 97   Plus

BS16055.3prime Sequence

270 bp (270 high quality bases) assembled on 2007-04-16

> BS16055.3prime
ATGGTCTAGAAAGCTTTTAGTTGGTGTTATTCGCGGCTCGCGCCTGCAGA
TGCTGCTGCTCTTCCACGTAGTTCTTCGCCTGGCGGCGCTTAAAAGTGCG
GTAGAAATTGGTCTCGCCCACTGTCCAATTGATCATGGAGAATTCCAGGC
CGGCGCCCAGTAAAAAGAAGAGCGGCAGGAAGCGGTAGACACCGAAGCGC
TTCTTTCCTGGCCAACTGTCCAGCAGACGACGCACGGATCCGCTGTACGG
ACTCATGTCGACTGATAACT

BS16055.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG32736-PA 240 CG32736-RA 1..240 256..17 1200 100 Minus
CG32736-PB 240 CG32736-RB 1..240 256..17 1200 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG42308-RB 640 CG42308-RB 165..406 258..17 1210 100 Minus
CG42308-RA 635 CG42308-RA 160..401 258..17 1210 100 Minus
CG32736-RB 635 CG32736-RB 160..401 258..17 1210 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7011601..7011756 258..103 780 100 Minus
X 23542271 X 7011818..7011903 102..17 430 100 Minus
Blast to na_te.dros performed on 2015-02-10 15:37:52 has no hits.

BS16055.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:40 Download gff for BS16055.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32736-PB 1..240 17..256 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 06:55:26 Download gff for BS16055.3prime
Subject Subject Range Query Range Percent Splice Strand
CG42308-RB 112..355 13..258 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:26:27 Download gff for BS16055.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32736-RB 160..403 13..258 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:26:27 Download gff for BS16055.3prime
Subject Subject Range Query Range Percent Splice Strand
X 7011601..7011756 103..258 100 -> Minus
X 7011818..7011905 13..102 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 06:55:26 Download gff for BS16055.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 6905634..6905789 103..258 100 -> Minus
arm_X 6905851..6905938 13..102 97   Minus

BS16055.complete Sequence

272 bp assembled on 2007-05-07

GenBank Submission: FJ638038

> BS16055.complete
GAAGTTATCAGTCGACATGAGTCCGTACAGCGGATCCGTGCGTCGTCTGC
TGGACAGTTGGCCAGGAAAGAAGCGCTTCGGTGTCTACCGCTTCCTGCCG
CTCTTCTTTTTACTGGGCGCCGGCCTGGAATTCTCCATGATCAATTGGAC
AGTGGGCGAGACCAATTTCTACCGCACTTTTAAGCGCCGCCAGGCGAAGA
ACTACGTGGAAGAGCAGCAGCATCTGCAGGCGCGAGCCGCGAATAACACC
AACTAAAAGCTTTCTAGACCAT

BS16055.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG32736-RB 240 CG32736-PB 1..240 17..256 1200 100 Plus
CG32736-RA 240 CG32736-PA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:10:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG42308-RB 640 CG42308-RB 165..406 15..256 1210 100 Plus
CG42308-RA 635 CG42308-RA 160..401 15..256 1210 100 Plus
CG32736-RB 635 CG32736-RB 160..401 15..256 1210 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7011601..7011756 15..170 780 100 Plus
X 23542271 X 7011818..7011903 171..256 430 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:10:30 has no hits.

BS16055.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:18:22 Download gff for BS16055.complete
Subject Subject Range Query Range Percent Splice Strand
CG32736-RB 1..240 17..256 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:14:38 Download gff for BS16055.complete
Subject Subject Range Query Range Percent Splice Strand
CG32736-RB 156..399 15..260 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:27:25 Download gff for BS16055.complete
Subject Subject Range Query Range Percent Splice Strand
CG42308-RB 114..351 17..254 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:18:23 Download gff for BS16055.complete
Subject Subject Range Query Range Percent Splice Strand
CG32736-RB 156..399 15..260 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:12:30 Download gff for BS16055.complete
Subject Subject Range Query Range Percent Splice Strand
CG32736-RB 162..399 17..254 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:12:30 Download gff for BS16055.complete
Subject Subject Range Query Range Percent Splice Strand
X 7011603..7011756 17..170 100 -> Plus
X 7011818..7011901 171..254 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:27:25 Download gff for BS16055.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6905636..6905789 17..170 100 -> Plus
arm_X 6905851..6905934 171..254 100   Plus

BS16055.pep Sequence

Translation from 16 to 255

> BS16055.pep
MSPYSGSVRRLLDSWPGKKRFGVYRFLPLFFLLGAGLEFSMINWTVGETN
FYRTFKRRQAKNYVEEQQHLQARAANNTN*

BS16055.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:55:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG32736-PB 79 CG32736-PB 1..79 1..79 421 100 Plus
CG32736-PA 79 CG32736-PA 1..79 1..79 421 100 Plus