Clone BS16058 Report

Search the DGRC for BS16058

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:160
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptSec61gamma-RA
Protein status:BS16058.pep: full length peptide match
Sequenced Size:16

Clone Sequence Records

BS16058.5prime Sequence

237 bp (237 high quality bases) assembled on 2007-04-16

> BS16058.5prime
GAAGTTATCAGTCGACATGGACAAGGTTGTTAAGTTTGCCGAGCCTGGAC
GCGCCTTCGCCAAGGACTCGATCCGCCTGGTCAAGCGGTGCACCAAGCCC
GACCGCAAGGAGTTCCAGAAGATCGCCATCGCCACTGCTGTGGGCTTCTG
CATCATGGGCTTCATCGGCTTCTTCGTTAAGTTGATACACATCCCCATCA
ACAATATCATCGTGGGCTCTTAAAAGCTTTCTAGACC

BS16058.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:31:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14214-PA 207 CG14214-RA 1..207 17..223 1035 100 Plus
CG8860-PA 207 CG8860-RA 1..200 17..216 475 89.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61gamma-RC 537 CG14214-RC 26..236 14..224 1055 100 Plus
Sec61gamma-RB 792 CG14214-RB 158..368 14..224 1055 100 Plus
Sec61gamma-RA 669 CG14214-RA 158..368 14..224 1055 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19643884..19644094 14..224 1055 100 Plus
2R 25286936 2R 12179594..12179793 216..17 685 89.5 Minus
Blast to na_te.dros performed on 2015-02-11 23:08:12 has no hits.

BS16058.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:43 Download gff for BS16058.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14214-PA 1..207 17..223 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 04:44:23 Download gff for BS16058.5prime
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 148..371 6..227 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:33:01 Download gff for BS16058.5prime
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 148..371 6..227 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:33:01 Download gff for BS16058.5prime
Subject Subject Range Query Range Percent Splice Strand
X 19643874..19644097 6..227 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 04:44:23 Download gff for BS16058.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 19537907..19538130 6..227 97   Plus

BS16058.3prime Sequence

237 bp (237 high quality bases) assembled on 2007-04-16

> BS16058.3prime
ATGGTCTAGAAAGCTTTTAAGAGCCCACGATGATATTGTTGATGGGGATG
TGTATCAACTTAACGAAGAAGCCGATGAAGCCCATGATGCAGAAGCCCAC
AGCAGTGGCGATGGCGATCTTCTGGAACTCCTTGCGGTCGGGCTTGGTGC
ACCGCTTGACCAGGCGGATCGAGTCCTTGGCGAAGGCGCGTCCAGGCTCG
GCAAACTTAACAACCTTGTCCATGTCGACTGATAACT

BS16058.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:31:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG14214-PA 207 CG14214-RA 1..207 223..17 1035 100 Minus
CG8860-PA 207 CG8860-RA 1..200 223..24 475 89.5 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:05:01
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61gamma-RC 537 CG14214-RC 26..236 226..16 1055 100 Minus
Sec61gamma-RB 792 CG14214-RB 158..368 226..16 1055 100 Minus
Sec61gamma-RA 669 CG14214-RA 158..368 226..16 1055 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:04:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19643884..19644094 226..16 1055 100 Minus
2R 25286936 2R 12179594..12179793 24..223 685 89.5 Plus
Blast to na_te.dros performed on 2015-02-12 05:04:58 has no hits.

BS16058.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:43 Download gff for BS16058.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14214-PA 1..207 17..223 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 07:20:08 Download gff for BS16058.3prime
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 148..371 13..234 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:31:50 Download gff for BS16058.3prime
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 148..371 13..234 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:31:50 Download gff for BS16058.3prime
Subject Subject Range Query Range Percent Splice Strand
X 19643874..19644097 13..234 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 07:20:08 Download gff for BS16058.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 19537907..19538130 13..234 97   Minus

BS16058.complete Sequence

239 bp assembled on 2007-05-07

GenBank Submission: FJ638041

> BS16058.complete
GAAGTTATCAGTCGACATGGACAAGGTTGTTAAGTTTGCCGAGCCTGGAC
GCGCCTTCGCCAAGGACTCGATCCGCCTGGTCAAGCGGTGCACCAAGCCC
GACCGCAAGGAGTTCCAGAAGATCGCCATCGCCACTGCTGTGGGCTTCTG
CATCATGGGCTTCATCGGCTTCTTCGTTAAGTTGATACACATCCCCATCA
ACAATATCATCGTGGGCTCTTAAAAGCTTTCTAGACCAT

BS16058.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:04:43
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61gamma-RC 207 CG14214-PC 1..207 17..223 1035 100 Plus
Sec61gamma-RB 207 CG14214-PB 1..207 17..223 1035 100 Plus
Sec61gamma-RA 207 CG14214-PA 1..207 17..223 1035 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:04:44
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61gamma-RC 537 CG14214-RC 26..236 14..224 1055 100 Plus
Sec61gamma-RB 792 CG14214-RB 158..368 14..224 1055 100 Plus
Sec61gamma-RA 669 CG14214-RA 158..368 14..224 1055 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19643884..19644094 14..224 1055 100 Plus
2R 25286936 2R 12179594..12179793 216..17 685 89.5 Minus
Blast to na_te.dros performed on 2014-11-28 01:04:42 has no hits.

BS16058.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:35 Download gff for BS16058.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 1..207 17..223 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:12:27 Download gff for BS16058.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 143..366 6..227 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:38:22 Download gff for BS16058.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 161..365 17..221 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:35 Download gff for BS16058.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 143..366 6..227 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:44:00 Download gff for BS16058.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61gamma-RA 161..365 17..221 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:44:00 Download gff for BS16058.complete
Subject Subject Range Query Range Percent Splice Strand
X 19643887..19644091 17..221 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:38:22 Download gff for BS16058.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19537920..19538124 17..221 100   Plus

BS16058.pep Sequence

Translation from 16 to 222

> BS16058.pep
MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFI
GFFVKLIHIPINNIIVGS*

BS16058.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61gamma-PC 68 CG14214-PC 1..68 1..68 348 100 Plus
Sec61gamma-PB 68 CG14214-PB 1..68 1..68 348 100 Plus
Sec61gamma-PA 68 CG14214-PA 1..68 1..68 348 100 Plus
CG8860-PA 68 CG8860-PA 1..68 1..68 339 98.5 Plus
CG13426-PA 105 CG13426-PA 48..104 10..66 196 64.9 Plus