Clone Sequence Records
BS16058.5prime Sequence
237 bp (237 high quality bases) assembled on 2007-04-16
> BS16058.5prime
GAAGTTATCAGTCGACATGGACAAGGTTGTTAAGTTTGCCGAGCCTGGAC
GCGCCTTCGCCAAGGACTCGATCCGCCTGGTCAAGCGGTGCACCAAGCCC
GACCGCAAGGAGTTCCAGAAGATCGCCATCGCCACTGCTGTGGGCTTCTG
CATCATGGGCTTCATCGGCTTCTTCGTTAAGTTGATACACATCCCCATCA
ACAATATCATCGTGGGCTCTTAAAAGCTTTCTAGACC
BS16058.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:31:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14214-PA | 207 | CG14214-RA | 1..207 | 17..223 | 1035 | 100 | Plus |
CG8860-PA | 207 | CG8860-RA | 1..200 | 17..216 | 475 | 89.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:08:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sec61gamma-RC | 537 | CG14214-RC | 26..236 | 14..224 | 1055 | 100 | Plus |
Sec61gamma-RB | 792 | CG14214-RB | 158..368 | 14..224 | 1055 | 100 | Plus |
Sec61gamma-RA | 669 | CG14214-RA | 158..368 | 14..224 | 1055 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:08:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 19643884..19644094 | 14..224 | 1055 | 100 | Plus |
2R | 25286936 | 2R | 12179594..12179793 | 216..17 | 685 | 89.5 | Minus |
Blast to na_te.dros performed on 2015-02-11 23:08:12 has no hits.
BS16058.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:43 Download gff for
BS16058.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14214-PA | 1..207 | 17..223 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 04:44:23 Download gff for
BS16058.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 148..371 | 6..227 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:33:01 Download gff for
BS16058.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 148..371 | 6..227 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:33:01 Download gff for
BS16058.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19643874..19644097 | 6..227 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 04:44:23 Download gff for
BS16058.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 19537907..19538130 | 6..227 | 97 | | Plus |
BS16058.3prime Sequence
237 bp (237 high quality bases) assembled on 2007-04-16
> BS16058.3prime
ATGGTCTAGAAAGCTTTTAAGAGCCCACGATGATATTGTTGATGGGGATG
TGTATCAACTTAACGAAGAAGCCGATGAAGCCCATGATGCAGAAGCCCAC
AGCAGTGGCGATGGCGATCTTCTGGAACTCCTTGCGGTCGGGCTTGGTGC
ACCGCTTGACCAGGCGGATCGAGTCCTTGGCGAAGGCGCGTCCAGGCTCG
GCAAACTTAACAACCTTGTCCATGTCGACTGATAACT
BS16058.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-10 02:31:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14214-PA | 207 | CG14214-RA | 1..207 | 223..17 | 1035 | 100 | Minus |
CG8860-PA | 207 | CG8860-RA | 1..200 | 223..24 | 475 | 89.5 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:05:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sec61gamma-RC | 537 | CG14214-RC | 26..236 | 226..16 | 1055 | 100 | Minus |
Sec61gamma-RB | 792 | CG14214-RB | 158..368 | 226..16 | 1055 | 100 | Minus |
Sec61gamma-RA | 669 | CG14214-RA | 158..368 | 226..16 | 1055 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:04:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 19643884..19644094 | 226..16 | 1055 | 100 | Minus |
2R | 25286936 | 2R | 12179594..12179793 | 24..223 | 685 | 89.5 | Plus |
Blast to na_te.dros performed on 2015-02-12 05:04:58 has no hits.
BS16058.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 14:01:43 Download gff for
BS16058.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14214-PA | 1..207 | 17..223 | 100 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 07:20:08 Download gff for
BS16058.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 148..371 | 13..234 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:31:50 Download gff for
BS16058.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 148..371 | 13..234 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:31:50 Download gff for
BS16058.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19643874..19644097 | 13..234 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 07:20:08 Download gff for
BS16058.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 19537907..19538130 | 13..234 | 97 | | Minus |
BS16058.complete Sequence
239 bp assembled on 2007-05-07
GenBank Submission: FJ638041
> BS16058.complete
GAAGTTATCAGTCGACATGGACAAGGTTGTTAAGTTTGCCGAGCCTGGAC
GCGCCTTCGCCAAGGACTCGATCCGCCTGGTCAAGCGGTGCACCAAGCCC
GACCGCAAGGAGTTCCAGAAGATCGCCATCGCCACTGCTGTGGGCTTCTG
CATCATGGGCTTCATCGGCTTCTTCGTTAAGTTGATACACATCCCCATCA
ACAATATCATCGTGGGCTCTTAAAAGCTTTCTAGACCAT
BS16058.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:04:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sec61gamma-RC | 207 | CG14214-PC | 1..207 | 17..223 | 1035 | 100 | Plus |
Sec61gamma-RB | 207 | CG14214-PB | 1..207 | 17..223 | 1035 | 100 | Plus |
Sec61gamma-RA | 207 | CG14214-PA | 1..207 | 17..223 | 1035 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:04:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sec61gamma-RC | 537 | CG14214-RC | 26..236 | 14..224 | 1055 | 100 | Plus |
Sec61gamma-RB | 792 | CG14214-RB | 158..368 | 14..224 | 1055 | 100 | Plus |
Sec61gamma-RA | 669 | CG14214-RA | 158..368 | 14..224 | 1055 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:04:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 19643884..19644094 | 14..224 | 1055 | 100 | Plus |
2R | 25286936 | 2R | 12179594..12179793 | 216..17 | 685 | 89.5 | Minus |
Blast to na_te.dros performed on 2014-11-28 01:04:42 has no hits.
BS16058.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:45:35 Download gff for
BS16058.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 1..207 | 17..223 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:12:27 Download gff for
BS16058.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 143..366 | 6..227 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:38:22 Download gff for
BS16058.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 161..365 | 17..221 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:45:35 Download gff for
BS16058.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 143..366 | 6..227 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:44:00 Download gff for
BS16058.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sec61gamma-RA | 161..365 | 17..221 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:44:00 Download gff for
BS16058.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19643887..19644091 | 17..221 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:38:22 Download gff for
BS16058.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 19537920..19538124 | 17..221 | 100 | | Plus |
BS16058.pep Sequence
Translation from 16 to 222
> BS16058.pep
MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFCIMGFI
GFFVKLIHIPINNIIVGS*
BS16058.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:34:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sec61gamma-PC | 68 | CG14214-PC | 1..68 | 1..68 | 348 | 100 | Plus |
Sec61gamma-PB | 68 | CG14214-PB | 1..68 | 1..68 | 348 | 100 | Plus |
Sec61gamma-PA | 68 | CG14214-PA | 1..68 | 1..68 | 348 | 100 | Plus |
CG8860-PA | 68 | CG8860-PA | 1..68 | 1..68 | 339 | 98.5 | Plus |
CG13426-PA | 105 | CG13426-PA | 48..104 | 10..66 | 196 | 64.9 | Plus |